Conserved Protein Domain Family
CydC

?
COG4987: CydC 
ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion, Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 227320
View PSSM: COG4987
Aligned: 16 rows
Threshold Bit Score: 407.871
Threshold Setting Gi: 16125013
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16801923   1 MRKS------SWIIPYIKeNRGLFLLVIFLGTLTFASAGALMFTSGHLISKSSLMPE------SIMAVYISTVGVRAFGI 68  Listeria innocua
15890884   5 FAILr-----PVIALFWStRRGMLLAGAVLAVTTVLAGIGLLGVSGWFITATAIAGLlpa-taFAFDVFAPSAAIRLLAL 78  Agrobacterium tumef...
15616534   1 MKALm-----PYVKMMFV-EKKDIFLSIFAGFMAGITAVGLFSASGYLISQAALTPP-------IATLMVIVAIVKLLGI 67  Bacillus halodurans
17989106   1 MHSLr-----PVLRLFFRsRAVALYAGIAAATITVLAGIALLGLSGWFITATAIAGLsaa-taVAFDVFAPAAGIRLLAI 74  Brucella melitensis
2829799    1 MKKE------EWILPYIKqNARLFVLVIFLGAVTIFSAAFLMFTSGFLISKAATRPE------NILLIYVPIVAVRTFGI 68  Bacillus subtilis
16125013   1 MPSSntp-ldDLIRAQKRqRAAGLRLAALSAVTVGAASTLLLGLSGWFIVASAAAGAaglaaaHAFNVLLPSAGIRFLAI 79  Caulobacter crescen...
1169168    1 MRTLl-----PFIRLFKF-AKFPLILGLVLMILGLGSSMGLLTVSGWFLAATAIAGLg-----TLFNFFYPSASVRGLAI 69  Haemophilus influenzae
15672689   1 MKLKnilfgnDWISPFLKkNRSGFILSIFLGTITISMAGLLMFSSGYVISKSATKPE------NILMIYVPVLFVRIFGI 74  Lactococcus lactis ...
15602436   1 MRALf-----PFLRLFKH-AKLTLFLGVLLMITGLAASIGLLTLSGWFLAATAIAGVg-----TLFNFFYPSAGVRGLAI 69  Pasteurella multocida
15641193   1 MRDLl-----PYLKLYKK-HWFGLTLGMLLALLTVLASIGLLTLSGWFLSAAAVAGLsi--arETFNYMLPGAFVRGFAM 72  Vibrio cholerae
16801923  69 MRSVSRYVERLSSHSLVLRILEKMRVRLYRLLEPQALLLKSRYKTGDILGLLAGDIEHLQNFYLTTMLPAIVSLVLYAIV 148 Listeria innocua
15890884  79 ARTAARYGERMTTHEATLSVLAALREKLFRGFAAPQAAKSLEARPARLLNRLTADIDALDSLYLRVLVPAAVAILAALVT 158 Agrobacterium tumef...
15616534  68 TSAISRYGERYFSHQATFTLLSNIRLRVYEKLEPVSSKILHHYRSGDLLSRIVGDVDSLQNLLLRVVYPPVVMVSVFLAT 147 Bacillus halodurans
17989106  75 LRTGARYLERLVTHDATLAVLAALREKLFRSWAQPSAAHALLKRPARLLFRLTADIDALDSLYLRVLVPIGAALATALFA 154 Brucella melitensis
2829799   69 ARSVSRYVERLVGHHIILKIVSDMRVRLYNMLEPGALMLRSRFRTGDMLGILSEDIEHLQDAFLKTIFPAISALLLYAVS 148 Bacillus subtilis
16125013  80 LRTAARYGERLSGHAAALRALAAIRPAVFESLAAAPPTESLALSRGEASARLVQDVDAIETRFVRLSAPWSAAAGLGAGV 159 Caulobacter crescen...
1169168   70 GRTVMRYFEKIVTHDATFRILSKLRVQVFEKIIPLSPAVLNRYRNSDLLNRLVSDVDTLDSLYLRLLAPFFTAVFVIIAM 149 Haemophilus influenzae
15672689  75 GRPVMHYVERLTSHNWILKITSLLRKKLYLRLEKTAVTLADRYRLGDLLGVLNEDIGNLQDLFLRTLFPVLIAGSLSIAL 154 Lactococcus lactis ...
15602436  70 GRTVARYFEKVVTHDATFRVLAKLRVQVFRRIIPLSPAVLNRYRNSDLLNRLVADVDTLDSLYLRLIAPFISAIVVIGLI 149 Pasteurella multocida
15641193  73 GRTAGRWGERVVTHNATFKLLTDLRVFFFEKLTPLIPGRLSAVRDADMLNRIVADVDAMDHVYLRLINPVTVGVLGIAAL 152 Vibrio cholerae
16801923 149 VILLGAFSIPFAALFVLLIGLLVLVLPWVSLLYARGKNAYLKQGRNSLYQKFTDAVFGISDWKFSGREKTFITNYEKDEA 228 Listeria innocua
15890884 159 GFGLAFLHPLAGVLAATFLIAAGLGISARSALKAEKFSRRRAIGLEALRARTADLVSGQTELLTTGRLSAQVAAVKRADD 238 Agrobacterium tumef...
15616534 148 IAFTSIFSVGTAVLLFIGLLATLLIIPTAFYVGHRAMNHHIRETRGNLSSTFTEYVYGFRELTIHQATDERQEQVLADIR 227 Bacillus halodurans
17989106 155 GVALGFMHPLFGLLVALTLLVIGLGLPVIAAMRSEPAMRRSAKGTEALRARAIDLVAGQTELLMAGRMEAQQAALVRADA 234 Brucella melitensis
2829799  149 VIALGFFSWPFAILLALYLFVLVVLFPVVSLLVTRAKNAKLKSGRNVLYSRLTDAVMGVSDWMFSGRRHAFIDAYEKEER 228 Bacillus subtilis
16125013 160 ALAL-LAGWIPALSILTAASAATLLARALARRYSAPARAAIQARTGALKDSVAALVSASAELRAYGLADWAGETLNARAA 238 Caulobacter crescen...
1169168  150 MIGLSFINIPLALGLGLFLLILLMIIPTVFYRLGQQFGERLIQARATYRTQFLEFIQAQAELLLFNAEDKLKEKMLVTEK 229 Haemophilus influenzae
15672689 155 IIAGGFFSLWFALGLALFLGFLIVILPLISLKFTVKLDEELKIYRNQLFSHLTDDILGLQDWVLSGRKEDFLTAYRGSEL 234 Lactococcus lactis ...
15602436 150 TFGLSFIHVPLALFIGLTLLCFLLIIPTVFYHLGTKFGEKLISSRATYRTQFVEFIQAQAELLLFNASTQHQQKLNQTEQ 229 Pasteurella multocida
15641193 153 TTLIAWFDPQLGMTLGAILLLVLLVWPTLFYRLGKKNGQHLTQNKAELRVRTLDWLQGYSELTIFGAEQTYRQAILTAQD 232 Vibrio cholerae
16801923 229 DMLRTENKQFHFVNWRDFFSQLVVGFMVIVMVYWSTAESRDGAFSGTMIAAFVLAIMALAEAFVPVS---SAISDKSLYQ 305 Listeria innocua
15890884 239 YLAACDDSLNRIETNAGFSFGLSAAILLSAALLGMACLVEHGAGSAPAAALGLLVCFAALEPFTALRr--GA-MELGRTL 315 Agrobacterium tumef...
15616534 228 TYEKQKQQSQAIHMWSDATVHFFSLFVSVAVLAYAGLQVVDGNLAGILLAMLLMISLTVFEQVTPMA---LLPYHLQESA 304 Bacillus halodurans
17989106 235 YMGSADKALNRIEIATGAGLGIAHAAILAGGLAGVGLLVGAGMIDAPVAVLGILIILGAMEPFAALRr--GA-MELGRTV 311 Brucella melitensis
2829799  229 DWFELERKKQRFTRWRDFAAQCLVAGLILLMLFWTAGQQADGELAKTMIAAFVLVVFPLTEAFLPLS---DALGEVPGYQ 305 Bacillus subtilis
16125013 239 SLEDARRAAARAQGLIVASQSVIAGLAVA---AAVACAAPAGAAL---AALAGLAAVMSLDALTSLA---AAFDQDGAAH 309 Caulobacter crescen...
1169168  230 TWQEDQAKEAKLSGFSTALVLFLNGLLIS-GMLWFASNADFGTDEYHTAYIALFT-FAALAAFEIIMplgAAFLHIGQVI 307 Haemophilus influenzae
15672689 235 SARKIQAKLLAFGRRRNLFLQVVYGALVIYLMIWSSGALRLGDAPN-YIAAVSLAAFPLFDAFSPLS---DAVVETQRYG 310 Lactococcus lactis ...
15602436 230 AWQAYQQKEANLAGLSSAILLLVNGFILS-ATLWFAAEADLGNGTYKAALMALFT-FSALASFEILMpigAAFLHIGQVI 307 Pasteurella multocida
15641193 233 KLLRNQYVNAQVSGLAQSLLLLANGWTLV-LMIWLAA-DGVGGQT-PDPLIALVA-FATMASVELLMpiaGAFQHLGQTL 308 Vibrio cholerae
16801923 306 DSLARLDKIEDPALPTFEEeTKEIARINTenvVLKAENLSFAYDNKSPKILNGFDFTLEQGEKVAIIGRSGTGKSTFLKL 385 Listeria innocua
15890884 316 FSARRIAPRLSATAEAHCP--A-LPASGI---AAELRGVRLEREGNEHPVLTNINLAIACGERVAIVGASGAGKTSLIQL 389 Agrobacterium tumef...
15616534 305 HSAKRLEAITAEPMEQPEHvDYNGQTAP----DLSLQHVTFTFDGEQRPALQDVSFYVKPGSKTAIIGASGSGKSTIAHL 380 Bacillus halodurans
17989106 312 LAARRVGPQLEEPAKAACL--P-LPVPGQ---AVVLENVSVRHEGAAATALKGFNLDIAEGERVAVVGTSGAGKSTLFNL 385 Brucella melitensis
2829799  306 DSIRRMNNVAPQPEASQTEsGDQILDLqd--vTLAFRDVTFSYDNSS-QVLHNFSFTLRQGEKMALLGRSGSGKSTSLAL 382 Bacillus subtilis
16125013 310 EARTRLDAVLRHRPKAAPS---------------SP-------PGPQ--PLTLLGLTLRPGERLAVSGPSGCGKTTAIET 365 Caulobacter crescen...
1169168  308 AAAERVTEIIEQKPLVEFNgNEEFETKVR---LISAKNLNFSYPEQETLVLKNLTLDLEQGKKIAILGKTGSGKSSLLQL 384 Haemophilus influenzae
15672689 311 DSIIRLNDLPDQDEEVRTE--EIVSTD------LVINNLQFSFEENK-KIFDNFNLEVKQGEHIALLGRSGVGKSTLAGL 381 Lactococcus lactis ...
15602436 308 ASAENVNDIIAQKAFVSFDgNEQFEQTEQp--LIEVENLSFRYPTRDNLALNRLNLRILSGQKVAILGKTGSGKSTLLQL 385 Pasteurella multocida
15641193 309 TSARRLNEIILAKPEVEFT-AQPTAHNGQy--NIEFNGVHFAYQANKPKAIDDFTLTLAQGQKVAIVGQTGSGKSTLIQL 385 Vibrio cholerae
16801923 386 VQGALLPTAGKVTMNGIEVENLRPQ-IPEITSMLNQKAHLFSTTVLNNIRLGNQD-ATDEEVYAAAKKVQLHDFIMSMPD 463 Listeria innocua
15890884 390 VA-------GELHPAAGSVRALPS-----TL--MTQRSQLFRDSIADNLRLAKPA-ATGVELWEALEAAGLAEHVRTLPK 454 Agrobacterium tumef...
15616534 381 ILKSFPYSKGSITVNGTELKHIDEKkWWKTINMSLQSNHFFVGTLEENLRTANEN-ASVEEMARALQQVELSHLQLGD-- 457 Bacillus halodurans
17989106 386 LA-------GEIAAESGSVAALPT-----RL--LTQRTELFQDSLRNNLLLAKPD-ATDAELIDALQAAGLGEFMRNAPA 450 Brucella melitensis
2829799  383 IEGALKPDSGSVTLNGVETALLKDQ-IADAVAVLNQKPHLFDTSILNNIRLGNGE-ASDEDVRRAAKQVKLHDYIESLPD 460 Bacillus subtilis
16125013 366 LLG--------LRESG----SLTP---REAFAWLPQDAGLVAGTVRDNLRLAAPT-ASDEDLWAALDDACLADRIRAAPE 429 Caulobacter crescen...
1169168  385 LVRNYDANQGELLLAEKPISAYSEEtLRHQICFLTQRVHVFSDTLRQNLQFASADkISDEQMIEMLHQVGLSKLLEQEGK 464 Haemophilus influenzae
15672689 382 IRGDLVPQSGSIQFSGVEPSKAKN--VEEKIGVINQSPYLFATSLRSNLTLAKLN-ASDAEIWEALELVGLRKMVESLPQ 458 Lactococcus lactis ...
15602436 386 LVRNYDAEQGNLRLAGKPIQHYSEQaLREQICFLTQRVHVFSDTLRNNLQIANANlIDDEKMIAVLQQVGLEKLLTQD-E 464 Pasteurella multocida
15641193 386 LCRYWDVQQGQITIGGTDIREWRESdLRAAISVVSQRVDILNGTLRDNLKLAKPD-ATDEALSDILQQVGLEKLLQDA-- 462 Vibrio cholerae
16801923 464 GYHTQMSEMGERFSGGERGRIALARILLQ-NTPIVILDEPTVGLDPITERDLLATIFETLA--DKSLIWVTHHLVGAEKM 540 Listeria innocua
15890884 455 RLETKLGEAGQGLSGGQSRRLALARFLLA-DRPLWLLDEVTEGLDGETARDVLGRLFARVE--GKTVLMITHNRREAEFA 531 Agrobacterium tumef...
15616534 458 ----RVDEKGANLSGGEKQRLAIARLLLRrHATLWILDEPTSSLDALTEERMLQLLFNQAK--DATVLFISHRLTGLEDM 531 Bacillus halodurans
17989106 451 GLDTALGEGGMGLSGGQARRLALARLFLT-DAPLWELDEPTEGLDHATAEDVLARLSEKAA--GRTLLIATHIGRETKIC 527 Brucella melitensis
2829799  461 GYHTSVQETGIRFSGGERQRIALARILLQ-DTPIIILDEPTVGLDPITERELMETVFEVLK--GKTILWITHHLAGVEAA 537 Bacillus subtilis
16125013 430 GLLAYVGDDGERLSGGERRRLALARAYLR-DAPWLLLDEPTEGLDPVTEAAVVARLDARLQrtGQGLVLVSHRAAPLAIC 508 Caulobacter crescen...
1169168  465 GLNLWLGDGGRPLSGGEQRRLGLARILLN-NASILLLDEPTEGLDRETERQILRLILQHAE--NKTLIIVTHRLSSIEQF 541 Haemophilus influenzae
15672689 459 KLLTPVDEAGERFSGGERQRLALARVLLS-DVDVVILDEPTVSLDPITENQLLSLFFEQLR--DKSIIFITHHLLGVHHM 535 Lactococcus lactis ...
15602436 465 GLDSWLGDGGRPLSGGEQRRLGLARVLLN-NAPILLLDEPTEGLDRETERQILRLILAHAQ--GKTLLMVTHRLTFIDQF 541 Pasteurella multocida
15641193 463 ALNTWLGEGGRQLSGGEKRRLGIARALLH-NAPILLLDEPTEGLDKQTEQQIMQLLHCHFG--HKTVLFITHRLVNLEQM 539 Vibrio cholerae
16801923 541 DRVLFLEEGKTLMEGRHAKLMA-EEPRYKRLYQLD 574 Listeria innocua
15890884 532 DRIIVLREGRQFDECQSGTLEY---GVVLETLRPD 563 Agrobacterium tumefaciens str. C58 (Cereon)
15616534 532 DQILVVDQGKIIETGTYEQLME-QNGYFRRMKELE 565 Bacillus halodurans
17989106 528 NRIIVLNQGALILSVRKGEPLF---DDILKTMR-- 557 Brucella melitensis
2829799  538 DKIVFLENGKTEMEGTHEELLA-ANERYRRLYHLD 571 Bacillus subtilis
16125013 509 PR--RVQFG--AQEKGPATVSP---SLVSTL---- 532 Caulobacter crescentus CB15
1169168  542 DKICVIDNGRLIEEGDYNSLITkENGFFKRLIERV 576 Haemophilus influenzae
15672689 536 DRVLFLENGSIKFDGKPASLLE-NNPTFKELYQLD 569 Lactococcus lactis subsp. lactis
15602436 542 DLLCMIDEATLIEQGNYHELSQlEQGYFRQLIERI 576 Pasteurella multocida
15641193 540 DAIALIEQGQLVEYGHHHTLLA-QHGRYHKLTQKL 573 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap