Conserved Protein Domain Family
COG4798

?
COG4798: COG4798 
Predicted methyltransferase [General function prediction only]
Statistics
?
PSSM-Id: 227135
View PSSM: COG4798
Aligned: 7 rows
Threshold Bit Score: 105.306
Threshold Setting Gi: 13471800
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17233361  23 LSAFVpsvlANQSRKPANLDgtttlqSILSSSHRSEENRQRDKYRHPTQTLSFFGLRPDMTVVELWPGSGWYTEILAPYL 102
gi 16125278  53 FMVPAlavlAFAIAAPAFAQvpaniaKAVADPSRPAAETARDAARRPGEILAMAELKPGDTVVDYIMGGGYFTRIISGAV 132
gi 16125602   1 MMGPP----PPPPSGPVAIAlpaniaAALSDPSRPAADMIRDKDRHPGEVLAFAGVKSGAKVADLIPGGGYFTRIFSKAV 76
gi 16126496  11 AAAFTlsapAAFAATDAALK------AAIASPTRPAADVARDGARHPYESLIFWGLKPKQTVIEVSPGGGYWTAILAPYA 84
gi 17233355     --------------------------------------------------------------------------------
gi 13474407   1 ---------------------------------------MYDQSKVS-ELIRFAGVDAGSIVIDVYPGEGDWTRLFSDVV 40
gi 13471800     --------------------------------------------------------------------------------
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17233361 103 AAKGqlIVTNFAPNDSKIPTVVFQQKLATAFQQKLEANKEVFGKIRVALInPPQELTLAPDNSVDMVVTFRNIHnw-vnA 181
gi 16125278 133 GPQG--VVYAYQPAEFIRFAARYGESLKAVT--AALANSKPLDGPITALD-LPDNVDAVITVQNYHDMHLKPFP-----T 202
gi 16125602  77 GPKG--KVYAYVPDELTKLAKRE-PAVNAIARDPVYSNVQVILNTLPNFG-APEKLDLVFTAQNYHDMHNKFMG-----P 147
gi 16126496  85 KATGgtYVAGVADLAN--PKLSEGARKGRADFEARFADEAKYGKPQFANFgPVSGPLGAPG-SADIVLTARNVHnwtvqP 161
gi 17233355     --------------------------------------------------------------------------------
gi 13474407  41 GPEG--RVYSFVPAEVADFKNDPVGRMRTLAKEPGRENVEAVSADLVAMPqATQPADVLWLHLFYHDLHTALIQk---kG 115
gi 13471800     --------------------------------------------------------------------------------
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17233361 182 GYAEQVYAAAYKALKPGGILGVEEHRAKPGISLQESIKTGYMSEDGVIAAVEKVGFKLVGKSEINANPQDtkdyPGGVWA 261
gi 16125278 203 DTAAKANAEIFKSLKPGGVFLVIDHSAIAGSGITAADTLHRIDIAAVKQEVEAAGFKLEAESGLLADPAD----ARTINV 278
gi 16125602 148 ANLGVVNRQVFRALKPGGVYLVLDHVADAGSGLRDTETLHRIDPAVVKAEVMAAGFVFEGETRVLRNPAD----PRAANV 223
gi 16126496 162 GVADKVFADFFAVLKPGGVLAVEEHRADP-RSEKAAGADGYLNTATVIAIAEKAGFKLDAQSEINANPKDtkdhPFGVWT 240
gi 17233355   1 ---------------------MEEHRAKPGISLQESIKMGYMSEDGVIAAVEKVGFKLVGKSEINANPQDtkdyPGGVWA 59
gi 13474407 116 ATAADFNRAVHERLKPGGSYVIVDHAAAAGSGTSDTQSLHRIDPASVREEVEAAGFVLDAESTMLANKDD----AHSIKV 191
gi 13471800   1 -------------------------MMFPGLPPSDTSLAMRRRGAVVVRDTLARG-RLGAESTILANKDD----SYSIKV 50
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 17233361 262 LPPTLRqgqkdr--------qrlvaiGESDRMTLKFIKPE 293
gi 16125278 279 FDPAIR--------------------GKTDQFILKFRKPK 298
gi 16125602 224 YDAGIR--------------------GKTEQFVYKFRKPA 243
gi 16126496 241 LPPVKRtapggqpadpnfdrskydaiGESDRMTLRFRKPA 280
gi 17233355  60 LPPTLRqgqkdr--------qrlvaiGESDRMTLKFVKPN 91
gi 13474407 192 FDPSIK--------------------GETDRFVYRFVKP- 210
gi 13471800  51 FDAWSK--------------------GETDRFAYRFLKI- 69
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap