Conserved Protein Domain Family
CitB

?
COG4565: CitB 
Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms]
Statistics
?
PSSM-Id: 226931
View PSSM: COG4565
Aligned: 19 rows
Threshold Bit Score: 279.522
Threshold Setting Gi: 19551319
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506732    2 INVLIIDDDAMVAELNRRYVAQIPGFQCCGTASTLEKAKEIIFNSDTpiDLILLDIYMQKENGLDLLPVLHNARCKSDVI 81
gi 15612961   2 IHVLIVEDDPMVAEFNKRYVKNVDGFHLVGIAYHVEEAKTVIE--EKkvDLILLDVYMPGENGLELLSYIRAEKLGIDVI 79
gi 15213979   7 IRVLLIEDDPMVQEVNRMFVEKLSGFTIVGTTATGEEGMVKTRELQP--DLILLDIFMPKQDGLSFIKQIREQYIDVDII 84
gi 21362407   2 IHIAIAEDDFRVAQIHERLIKQLDGFKIIGKAANAKETLALLKEHKA--DLLLLDIYMPDELGTALIPDIRSRFPEVDIM 79
gi 15213975   6 WKVLLIEDDPMVQEVNKDFITTVKGVTVCATAGNGEEGMKLIKEEQP--DLVILDVYMPKKDGIKTLQEIRKQKLEVDVI 83
gi 16080205   2 INVLIVEDDPMVGELNKRYLSQIDGFQLKGIASSFQSALHILG--EHhiDLILLDIYMPGKNGLELLTELRAQNEAVDVI 79
gi 19551319   5 LKVLVIDDDFRVAGIHASIVDASPGFSVVGTARTLAEAKTLIATFSP--DLLLVDVYLPDGDGIDLVGTSN-----IDAF 77
gi 15641612   3 tRLLIIEDDAAIAQLHHRYLSQLEGFEVVGIAMSQADARLQMEVLNP--DLVLLDVYLPDGTGLELLQWIRGRNVHCDVI 80
gi 2506732    2 INVLIIDDDAMVAELNRRYVAQIPGFQCCGTASTLEKAKEIIFNSDTpiDLILLDIYMQKENGLDLLPVLHNARCKSDVI 81
gi 2506732    2 INVLIIDDDAMVAELNRRYVAQIPGFQCCGTASTLEKAKEIIFNSDTpiDLILLDIYMQKENGLDLLPVLHNARCKSDVI 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2506732   82 VISSAADAATIKDSLHYGVVDYLIKPFQASRFEEALTGWRQKKMALEKHQYYDQAELDQLIHGSSSnEQDPRRLPKGLTP 161
gi 15612961  80 LITAASDADHIQTALRYGAVDYLIKPFEFERFEQALLSYKDKQYALREKEQLNQEELDQLLLSDDKdPDQEIALPKGLTQ 159
gi 15213979  85 AVTAANDTKTIKTLLRYGVMDYLVKPFTFERLKAALTQYEEMFRKMQKEAELSQDSLDEMIKQKQA-QANMDDLPKGLHA 163
gi 21362407  80 IITAATETRHLQEALRAGIAHYLIKPVTADKFRQVLLQYKEKRKLLMSQPEVSQSMIDHIFGNGVKtALPAEDLPTGINS 159
gi 15213975  84 VVSAAKDKETISLMLQNGAVDYILKPFKLERMRQALEKYKQYKQKIEANDTLSQEQLDAILN--IP-QQAVQDLPKGLNH 160
gi 16080205  80 VISAASELDVIKKTLRYGAVDYLIKPFEFERFQTALSDYRRKQKVYSTHRNMSQKELDAELFQK-KeATEKVQLPKGLTK 158
gi 19551319  78 VLSAADDIKTVRRAMRAGALGYLLKPFPQKRLVERLDRYVRYRHVLSGTQGLSQDKIDQATAILNG-TQAPVTVS---RS 153
gi 15641612  81 LITAAREVETLQQAMRGGVVDYLLKPVMFPRLETALRKYQMRQAELKQLADFDQQKVDKMFTTHSS-EALPQRLPKGIDA 159
gi 2506732   82 VISSAADAATIKDSLHYGVVDYLIKPFQASRFEEALTGWRQKKMALEKHQYYDQAELDQLIHGSSSnEQDPRRLPKGLTP 161
gi 2506732   82 VISSAADAATIKDSLHYGVVDYLIKPFQASRFEEALTGWRQKKMALEKHQYYDQAELDQLIHGSSSnEQDPRRLPKGLTP 161
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 2506732  162 QTLRTLCQWIDaHQDYEFSTDELANEVNISRVSCRKYLIWLVNCHILFTSIHYGVTGRPVYRYRIQAE 229
gi 15612961 160 STLQIIVEEIRkIGETPFSTDELAEQTEISRVSIRKYLKFLVDIECLEERLTYG-IGRPVYSYQYIKE 226
gi 15213979 164 HTLQQVIERLE-ELDEPKSAEEIGRDVGLARVTVRRYLNYLESVGQVEMDLTYGSIGRPIQTYKLKQG 230
gi 21362407 160 ITLRKIKEALQtAS-EGLTAEELGEKMGASRTTARRYAEYLVSKEEARAELEYGIIGRPERKYYLAAD 226
gi 15213975 161 FTMNEVTAFLK-QQTASLSAEEVAKALGIARVTARRYLDYLEKTGIIKLDVQYGGVGRPVNRYVLKG- 226
gi 16080205 159 STLKLIWSSIQsFENESFTTEDLAKHTEISQVSIRKYLKFLEDIQVLNVEMAYGTIGRPVFQYNVNNS 226
gi 19551319 154 ATEQLLLDALE---GQELSATEASEAAGVSRATAQRRLAAMASQGVIQVRLRYGQSGRPEHLYSKPLL 218
gi 15641612 160 VTLDKIRLLFQ--TATMLTADEAGEKIGASRTTARRYLEYLITAGELEADLSYGTVGRPERTYRKLHR 225
gi 2506732  162 QTLRTLCQWIDaHQDYEFSTDELANEVNISRVSCRKYLIWLVNCHILFTSIHYGVTGRPVYRYRIQAE 229
gi 2506732  162 QTLRTLCQWIDaHQDYEFSTDELANEVNISRVSCRKYLIWLVNCHILFTSIHYGVTGRPVYRYRIQAE 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap