Conserved Protein Domain Family
PduX

?
COG4542: PduX 
Protein involved in propanediol utilization, and related proteins (includes coumermycin biosynthetic... [Secondary metabolites biosynthesis, transport and catabolism]
Statistics
?
PSSM-Id: 226917
View PSSM: COG4542
Aligned: 5 rows
Threshold Bit Score: 353.32
Threshold Setting Gi: 13488400
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13488128  32 IIAKDGLQPRVHSSDALCCGTFGELLQGQLPVgsiardSHFLVTMPIALFARAHFIPIA-GTRSVTVYPSHKVKAKRLAE 110 Mesorhizobium loti
15894650   1 -----------MKISAKYPASVGEVVQGSFNG------KDVLMSFPVSLFTEVTLFERKaSKDKYNNLKTMMFLENILNR 63  Clostridium acetobu...
16765388   1 MRAHYSYLKGDNVAVAQCPASCGELIQGWILG------SEKLVSCPVDWYSTVAVTAAPpLINERPLSRA--MVERVLAH 72  Salmonella typhimur...
16800203   1 -----------MEIKATCPASCGELLQGFITG------GEKLISYPINWYSEVTLSDKS-GQNSQGHTKAWLAFEVTCEY 62  Listeria innocua
13488400   7 GDLMSRGALPSPVGTAIAIAHHGELIQGVFKDddg-rlHRGLVTLPIAGLRSEARFDRS-DGDAVVVTPDHKIKAAAAAR 84  Mesorhizobium loti
13488128 111 NLVTALSATG-GVLLLQSELPEGKGLASSSADLVATARSIACCFRRRVRTSLIEKLMAEIE-PSDGVMYPG-VVAYQQRA 187 Mesorhizobium loti
15894650  64 WGFEKYINN--IDIIISSNIPRGKGFASSTADLCALYYALLRFFGREFNERELIEECINIE-PTDSIIFDK-ATVFDYKE 139 Clostridium acetobu...
16765388  73 WQYPAHWSNE-IRVDVRSSIPVAKGMASSTADIAATAVATAHHLGHSLDETTLAQLCVSIE-PTDSTVFHQ-LTLFDHNN 149 Salmonella typhimur...
16800203  63 FGVTKKERPP-ISLLVKSTIPVAKGMASSTADIAATIGATAKWLNKPITETEIAKLCLQLE-PTDSTIFKS-LTLFDHLK 139 Listeria innocua
13488400  85 LTLDFLNVTGgGALTLQSSIPVGHGYGSSTADVVAAIRAVAAALNVQLRPSSIARLAVSAErASDAIAFDDhAVLFAQRE 164 Mesorhizobium loti
13488128 188 CRLLS-FLGQMPPLAIVGIDEGGTVETVDYDQ-RRGEISTNQRAEYQELLNRARIAIPWGDAATIGKIATSSALLHQERT 265 Mesorhizobium loti
15894650 140 GSYKK-TLGEYPKLHILVFEGKRIIDTVSFN-----KKELKPLKDVGNLIKKVEKALKVGSVKDIGEAATLSIVKNCDRL 213 Clostridium acetobu...
16765388 150 AATQI-ACEPPPPIDLLVLESPVTLRTQDYHRlPRQQKLIASSATLQQAWNLVQEACITQNPLRLGEAATLSAIASQTLL 228 Salmonella typhimur...
16800203 140 GSVIE-SSNWMPKLGVVVLEPLTVLETATYRQeDHHEQLLENEQQLAKAVQFFNQAAAQKSINLLGKAATVSAASNQIIL 218 Listeria innocua
13488400 165 GRVIEnFAGSLPPLLLLGFKANGGVPVDTLQLpP-ARYDSAEIQEFGVLRALVARAVRLQDPHLLGRAASASAVISQRHL 243 Mesorhizobium loti
13488128 266 PKKHLNSMLKACEATSALGVIVAHSGTMIGILLDRMAADFPRKLRSVLARVAPFYNSPKIYLTM 329 Mesorhizobium loti
15894650 214 SYDILGKVLRLKDETCGIGIIGAHSGDMLGIIYDDKYALDSAKERVENIKNYKIYELETLLRAE 277 Clostridium acetobutylicum
16765388 229 PKPGFTALLSLVEECDLYGLNVAHSGSVVGLMLDRK-RHDIARLKGKLAEKKLTRHWPKQHLLK 291 Salmonella typhimurium LT2
16800203 219 PKPFWNELLEVVSCLNLVGINVSHSGTVVGLLYELG-KIDPLEILFELERRYVTTFYSRYYFRE 281 Listeria innocua
13488400 244 PKQGFDEIADIAERAGACGVQVAHSGSLLGLIFDLFTPNLKRRAALVAQQIRRAGFKDVEVHLV 307 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap