Conserved Protein Domain Family
COG4370

?
COG4370: COG4370 
Uncharacterized protein [Function unknown]
Statistics
?
PSSM-Id: 226807
View PSSM: COG4370
Aligned: 4 rows
Threshold Bit Score: 492.855
Threshold Setting Gi: 15807605
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17232384  14 PMATSRLQLLVLSNGHGEDVIAVRILQALLQQA--NPPDIYA-LPLVGEGLAYQNLNIPLIGAVRTMPSGGFIYMDGRQL 90
gi 15807605   1 MPLTVAPATLLVSNGHAEDLIGAALARELRRRR---PDQPLLaLPLVGAGGAYAG-LAETAGPLLDMPSGGFPFGSLDNL 76
gi 16331438   1 -MLP---KILLLSNGHGEDAIAVSIGQAWSELAgmEPGEILVgLPLVGEGNSYRRLNILLIGPVKTMPSGGFNNMDAREL 76
gi 16329785   1 ------MKILFISNGHGEDLNAGLIIDALQRRS--PEFELFA-LPLVGEGKAYQNRGISIIAPTQPLPSGGIIYTGFLTW 71
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17232384  91 ARDVRGGLVQLTWSQIQAVRRWVSSQKKLGNNNAILAVGDIVPLLFAFISGANYAFVGTAKSEYYVRDEVGLLPRKSKAA 170
gi 15807605  77 RADLRAGLVQKSLGQWLAARTQGPALERVVVVGDTYALGVGTLAARQIPGALARPRLPLVHVQPLVSVLYGEGMTLGGHL 156
gi 16331438  77 WRDVQGGLWGLTKAQLGGLQKWTAQ----GGK--VLAVGDIVPLALAWLGRGDYAFVGTAKSEYYLRSPAGAWLPSTQA- 149
gi 16329785  72 WRDIVGGLVGLTIKQIKALLKQKHQ-----FD-LIVAIGDIVPLAFARLSGKPYLSFLVANSSYY---EGRLSLPFTVT- 141
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17232384 171 RWENFSGS-IYHPWerWLMSRRRCRAVFPRDGLTTQTLKNWPIPAFDVGNPMMDGLEP-KVSPQLFYMANAryqemdrpl 248
gi 15807605 157 RELNALGAnVFMPW--ELALGRRAWRVYTRDAASARHLARRGVNAAYRGSFALDILPApERDLAPLLTGVP--------- 225
gi 16331438 150 -WEKWLGC-AYYPWerWLMTRKNCVAVFPRDRLTHESLLNQGVASYAVGNPMMDGLNPqDYKPQTLQPGQSl-------- 219
gi 16329785 142 ----------------WCLKSRHCLGAIAKDNFTAQDLSQRGINIRWLGYPIMDALQP--TGQQLRRDSKT--------- 194
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17232384 249 VITLLPGSRPPEAYQNWQIIMTSVSALMGSFQErdtflpssgsVVFLGAIASGLDLNILAQTVQSQGWRPHADlplplq- 327
gi 15807605 226 VLALLPGQR-GDAQTSLPVMLGAACALPDMQAL-----------VAWPRPFDELPPLLGWTLEERGEWGVLAR------- 286
gi 16331438 220 TITLLPGSRSPEMERNWALIVESLTSVLAHFADa--------sITFLAAIAPSLPLPTLMAELETQGWQPLEDnavellt 291
gi 16329785 195 LIALLPGSRVPEAVHNLAQLLP-LCGAIAQEKA----------VDFWAALVPAVTVEHLQNLAREHGWQYHGD------- 256
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17232384 328 -----dsnalIFKQRNAYLILTQQSYNECLHWGDV----AIAMAGTATEQFIGLGKPAIAIPGQGPQYNPGFAEAQSRLL 398
gi 15807605 287 -----------RG--TCSVWLLRASFSTILHAAAAsggvALGTAGTANEQAAGLGVPVVGFPTAGPQYVPGFAVRQQRLL 353
gi 16331438 292 nkvsclikgpVFQKDHARLVFSQQQFADCLHHAQA----AIAMAGTATEQFVGLGKPVISFPGQGPQYNPYFARRQTWLL 367
gi 16329785 257 ----------RLEKDNCTIHCSWDQFADILHQADL----VLGMAGTAVEQAVGLGKPVLQIPGHGPQFTYGFAEAQMRLL 322
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 17232384 399 GLSLILVEEAAQVAPVVRS-------LFTNPDSLHIIRENGVRRMGKPG----AARRIAECLLEKFG 454
gi 15807605 354 GAALTLTRPEASAAAQAVRe------LLGGPQRTTAVR-DGQRRIGQAG----ALPQIAEELGKMA- 408
gi 16331438 368 GESLILLNSPDQTGEALQQ-------VLHDVERLEAIACNGRERLGQAG----AARRIAEILREQWC 423
gi 16329785 323 GCSVTTVGKNPQEANLISQasqkalaILADQHYQQRCRHNGQERIGSPGgslaIANHIAATAKTLAD 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap