Conserved Protein Domain Family
YejE

?
COG4239: YejE 
ABC-type microcin C transport system, permease component YejE [Secondary metabolites biosynthesis, transport and catabolism]
Statistics
?
PSSM-Id: 226690
View PSSM: COG4239
Aligned: 16 rows
Threshold Bit Score: 329.728
Threshold Setting Gi: 15595091
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15887543  31 RPWFS-----PTTKRRWQNFKANRRGYWSFWLFLILFFLSLIAEFIANDKPILASYKGEILVPVMVDYPEEKFGG-FLAQ 104 Agrobacterium tumef...
17988220  16 RPWLS-----PLNKRRWQNFKANRRGYWSLWIFLFLLAAALCSEFIANDRPILVSYKGELLMPVFVDYPEDKFGG-FYAI 89  Brucella melitensis
15644879   1 ---MS-----SLFKMRILSFKKNKRAVFSLYLFIALLALSLLAPLWVNDRPLFIYKDNKAYFPMFKNYAEVEFGGdFFTP 72  Helicobacter pylori...
15597005   1 -MRLS-----PINQRRWARFKSNKRGWWSLWLFLILFVGSLGAELIANDKPLVVHYDGGWYFPVFKRYPETTFGGeFPLE 74  Pseudomonas aerugin...
15597256   2 AIVLS-----PLHRRRLAAFRANRRGRLALRLFLALFVTCLFAELIANDRPLLLEYRGQWFLPVLRDYPETAFGGeLPFP 76  Pseudomonas aerugin...
17545894  19 AVRHSp----SPLKRAWRRFKQHRLGYWSLILFVALFVLSLLSEAISNDRPLVVKYHGQWYFPIVKTYPETTFDGdFTTP 94  Ralstonia solanacearum
15963907  13 KGWLT-----PIGRRRWQNFKANRRGYWSLWLFLLLFGLSLFAEFIANDKPILASYKGEILVPVLFDYPEEKFGG-FLAE 86  Sinorhizobium meliloti
15601348   4 MTKASkrvpnPLTEARWARFKANRRGFWSLWIFLLLFVVSLFAELIANDKPLLIQYDGAWYMPIVQRYSETQFGGeFDTE 83  Vibrio cholerae
15611306   1 ---MS-----GLFKMRILSFKKNKRAVFSLYLFIALLALSLLAPLWVNDRPLFIYKDNKAYFPMFKNYAEVEFGGdFFTP 72  Helicobacter pylori...
13474579   3 RPFLS-----PLNKRRLQNFKANRRGYWSLWIFLVLFVLSLFAEFIANDKPIIASYKGEILFPVLVAYPEEKFGG-FYAV 76  Mesorhizobium loti
15887543 105 TDYKSSFIQDEINA-NGWMIWPPIRYSYQTVNSNIPHSAPTAPFWLmdekercsaypqgnadpgctlgnlNWLGTDNQAR 183 Agrobacterium tumef...
17988220  90 TDYRDPVIQDEINA-HGWAIWPPVRYSYNTVNNEIPEAAPSKPFWLyspqvrcqryplgindpncrfgnfNLLGTDDQAR 168 Brucella melitensis
15644879  73 TDYNDPYVQNTLLK-DAFIIHALIPYSYDTIIMDLDSPAPTPPSFK------------------------HLLGTDDQAR 127 Helicobacter pylori...
15597005  75 ANYKSPYISQLIAEkDGWVLWPPIPYSYDTINYELKVPAPAPPSAE------------------------NWLGTDDQAR 130 Pseudomonas aerugin...
15597256  77 PDYRGRFMSERIAR-DGWALWPPIRFDARSINYAR--PAPAPPSAE------------------------NWLGTDDQGR 129 Pseudomonas aerugin...
17545894  95 TDYLDPYIRDKFNApGNFALYPPNPYSYETLNYFAKEPNPAPPSAE------------------------NWLGTDDRGR 150 Ralstonia solanacearum
15963907  87 TDYRSDFIRDEIGA-NGWMIWPPIRYSYQTVNSSIPHSAPTPPFWLmseeercsaypqgaddpgciagnlNWLGTDDQAR 165 Sinorhizobium meliloti
15601348  84 ADYTDPYVVSLIEE-KGQIIWPLIRFHYDTINFDITGSVPSAPDSV------------------------NWLGTDDKGR 138 Vibrio cholerae
15611306  73 TDYNDPYVQNTLLK-DAFIIHALIPYSYDTIIMDLDSPAPTPPSFK------------------------HLLGTDDQAR 127 Helicobacter pylori...
13474579  77 TDYRDPVIQDEINA-NGWMIWPPIRYSYQTVNNAIPEAAPARPSWQydaakrcnqypqgaadpacivgnwNWLGTDDQAR 155 Mesorhizobium loti
15887543 184 DVTARMIYGFRISVLFGLTLTIASALVGVTAGAIQGYFGGWTDLLLQRFIEIWSSMPVLYILLIIAAILPPGFFVLLGIM 263 Agrobacterium tumef...
17988220 169 DVFARALYGFRISVLFGLILTFFSAIIGVTAGAVQGYFGGWVDLLFQRFIEIWSSIPVLYLLLIIAAILPPGFWVLLGIM 248 Brucella melitensis
15644879 128 DVLARLVYGYRVSLIFGILLTLFSVLIGVSLGAFQGYYGGLVDLVGQRLSEIWSAIPMLFLLIVISSAFNSNFWIILFLV 207 Helicobacter pylori...
15597005 131 DVLARVIYGFRVSILFALTLTVLSSLIGVTVGALQGYYGGWVDLLGQRFLEVWSGLPVLYLLIILASFVQPNFWWLLGIM 210 Pseudomonas aerugin...
15597256 130 DVLARVIYGLRLSILFALGLTLASSLLGICAGAVQGYYGGWIDLFGQRFIEVWSGLPMLYLLIILASLVQPGVGWLLAIM 209 Pseudomonas aerugin...
17545894 151 DVFARLLYGFRVSVLFGLALTLIGVLVGTLTGALMGFFGGRFDLVSQRLIEVWGSMPELYLLIIFASIFEPSLGLLIVLL 230 Ralstonia solanacearum
15963907 166 DVMARMIYGFRISVLFGLALTIASAVIGVSAGAVQGYFGGWTDLLMQRFIEIWSSMPVLYILLIIAAILPPGFFILLGIM 245 Sinorhizobium meliloti
15601348 139 DVLARIIYGFRISVLFGFILTVISSLIGVLIGATQGYYGGWLDLFGQRFIEVWSGMPTLFLLIILSSFVEPNFWWLLGIM 218 Vibrio cholerae
15611306 128 DVLARLVYGYRVSLVFGILLTLFSVLIGVSLGAFQGYYGGLVDLVGQRLSEIWSAIPMLFLLIVISSAFNSNFWIILFLV 207 Helicobacter pylori...
13474579 156 DVLARVIYGFRISVLFGLILTAGSALIGVGAGALQGYFGGWTDLLFQRFIEIWSAIPVLYLLLIVAAILPPGFFILLGLM 235 Mesorhizobium loti
15887543 264 LLFSWVGFVGIVRAEFLRARNFEYVRAARALGVGNWTIMFRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGS 343 Agrobacterium tumef...
17988220 249 LLFSWVAFVGVVRAEFLRARNFEYVNAARALGVKNGTIMWRHLLPNAMVATLTFLPFILNGSITTLTSLDFLGFGLPPGS 328 Brucella melitensis
15644879 208 LLFSWMGLSQVVRTEFLKARNMDYTKAARALGVNDLKIIFYHVLPNALVATITYVPFLMAASISTLVSLDFLGFGMPIGS 287 Helicobacter pylori...
15597005 211 LLFSWMSLVDVVRAEFLRGRNLEYVRAARALGMRNSAIMFRHILPNAMISTLTFMPFILTGAIGTLTSLDFLGFGLPPGA 290 Pseudomonas aerugin...
15597256 210 LLFSWTSLVDVVRAEFLRGRHLEYVKAARTLGLGDAGVMFRHILPNAMVATLTFLPFLLCGAVTTLTALDFLGFGLPPGS 289 Pseudomonas aerugin...
17545894 231 SLFGWMSLSAYVRAEFYRNRSLDYVKSARAMGLSDGQIIRRHILPNSLTPIITFLPFNMSAAILTLTSLDFLGLGVPPSM 310 Ralstonia solanacearum
15963907 246 LLFSWVGFVGVVRAEFLRARNFEYVNAARALGVGNGTIMYRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGS 325 Sinorhizobium meliloti
15601348 219 VLFSWMSLVGVVRAEFLRCRNFDYVRAAQAMGVSDMRIILRHMLPNAMVASLTMMPFILSGSVTTLTSLDFLGFGLPAGS 298 Vibrio cholerae
15611306 208 LLFSWMGLSQVVRTEFLKARNMDYTKAARALGVNDLKIIFYHVLPNALVATITYIPFLMAASISTLVSLDFLGFGMPIGS 287 Helicobacter pylori...
13474579 236 LLFSWVALVGVVRAEFLRARNFEYVNAARALGVPNRTIMFRHLLPNAMVATLTFLPFLLSGSISTLTSLDYLGFGLPPGS 315 Mesorhizobium loti
15887543 344 PSLGEMIAQGKNNLQAPWLGLTAFFTMSIMLSLLIFVGEAVRDAFDPRKTF 394 Agrobacterium tumefaciens str. C58 (Cereon)
17988220 329 ASLGELLAQGKNNLQAPWLGITGFVVISAMLSLLIFIGEATRDAFDPRKAF 379 Brucella melitensis
15644879 288 ASLGELVNQGKDNLTTPHLAIVAFVAISLLLSVLVFIGEGVRDAFNANMLK 338 Helicobacter pylori 26695
15597005 291 PSLGELVAQGKSNLQAPWLGISAFVVLAVMLSLLVFIGEAARDAFDPRK-- 339 Pseudomonas aeruginosa PA01
15597256 290 PSLGELVGQGRDNLQAPWLGLTVFVVLATLLSLLVFIGEAVRDAFDPRT-- 338 Pseudomonas aeruginosa PA01
17545894 311 PSLGELLAQGKANLDAWWISLSTFVTLVLILVLLTFMGDALRDAFDTRLSF 361 Ralstonia solanacearum
15963907 326 PSLGEMIAQGKSNLQAPWLGLTAFFAMSIMLSLLIFVGEATRDAFDPRKTF 376 Sinorhizobium meliloti
15601348 299 PSLGELLAQGKANLQAPWLGISAFVVLSVMLTLLVFIGEAVRDAFDPHLQR 349 Vibrio cholerae
15611306 288 ASLGELVNQGKDNLTTPHLAVVAFVAISLLLSVLVFIGEGVRDAFNANMLK 338 Helicobacter pylori J99
13474579 316 ASLGELLKQAQRNLNAPWLGISGFVVISLMLSLLVFVGEATRDAFDPRKTF 366 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap