Conserved Protein Domain Family
YejE

?
COG4239: YejE 
ABC-type microcin C transport system, permease component YejE [Secondary metabolites biosynthesis, transport and catabolism]
Statistics
?
PSSM-Id: 226690
View PSSM: COG4239
Aligned: 16 rows
Threshold Bit Score: 329.728
Threshold Setting Gi: 15595091
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15887543  31 RPWFS-----PTTKRRWQNFKANRRGYWSFWLFLILFFLSLIAEFIANDKPILASYKGEILVPVMVDYPEEKFGG-FLAQ 104
gi 17988220  16 RPWLS-----PLNKRRWQNFKANRRGYWSLWIFLFLLAAALCSEFIANDRPILVSYKGELLMPVFVDYPEDKFGG-FYAI 89
gi 15644879   1 ---MS-----SLFKMRILSFKKNKRAVFSLYLFIALLALSLLAPLWVNDRPLFIYKDNKAYFPMFKNYAEVEFGGdFFTP 72
gi 15597005   1 -MRLS-----PINQRRWARFKSNKRGWWSLWLFLILFVGSLGAELIANDKPLVVHYDGGWYFPVFKRYPETTFGGeFPLE 74
gi 15597256   2 AIVLS-----PLHRRRLAAFRANRRGRLALRLFLALFVTCLFAELIANDRPLLLEYRGQWFLPVLRDYPETAFGGeLPFP 76
gi 17545894  19 AVRHSp----SPLKRAWRRFKQHRLGYWSLILFVALFVLSLLSEAISNDRPLVVKYHGQWYFPIVKTYPETTFDGdFTTP 94
gi 15963907  13 KGWLT-----PIGRRRWQNFKANRRGYWSLWLFLLLFGLSLFAEFIANDKPILASYKGEILVPVLFDYPEEKFGG-FLAE 86
gi 15601348   4 MTKASkrvpnPLTEARWARFKANRRGFWSLWIFLLLFVVSLFAELIANDKPLLIQYDGAWYMPIVQRYSETQFGGeFDTE 83
gi 15611306   1 ---MS-----GLFKMRILSFKKNKRAVFSLYLFIALLALSLLAPLWVNDRPLFIYKDNKAYFPMFKNYAEVEFGGdFFTP 72
gi 13474579   3 RPFLS-----PLNKRRLQNFKANRRGYWSLWIFLVLFVLSLFAEFIANDKPIIASYKGEILFPVLVAYPEEKFGG-FYAV 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15887543 105 TDYKSSFIQDEINA-NGWMIWPPIRYSYQTVNSNIPHSAPTAPFWLmdekercsaypqgnadpgctlgnlNWLGTDNQAR 183
gi 17988220  90 TDYRDPVIQDEINA-HGWAIWPPVRYSYNTVNNEIPEAAPSKPFWLyspqvrcqryplgindpncrfgnfNLLGTDDQAR 168
gi 15644879  73 TDYNDPYVQNTLLK-DAFIIHALIPYSYDTIIMDLDSPAPTPPSFK------------------------HLLGTDDQAR 127
gi 15597005  75 ANYKSPYISQLIAEkDGWVLWPPIPYSYDTINYELKVPAPAPPSAE------------------------NWLGTDDQAR 130
gi 15597256  77 PDYRGRFMSERIAR-DGWALWPPIRFDARSINYAR--PAPAPPSAE------------------------NWLGTDDQGR 129
gi 17545894  95 TDYLDPYIRDKFNApGNFALYPPNPYSYETLNYFAKEPNPAPPSAE------------------------NWLGTDDRGR 150
gi 15963907  87 TDYRSDFIRDEIGA-NGWMIWPPIRYSYQTVNSSIPHSAPTPPFWLmseeercsaypqgaddpgciagnlNWLGTDDQAR 165
gi 15601348  84 ADYTDPYVVSLIEE-KGQIIWPLIRFHYDTINFDITGSVPSAPDSV------------------------NWLGTDDKGR 138
gi 15611306  73 TDYNDPYVQNTLLK-DAFIIHALIPYSYDTIIMDLDSPAPTPPSFK------------------------HLLGTDDQAR 127
gi 13474579  77 TDYRDPVIQDEINA-NGWMIWPPIRYSYQTVNNAIPEAAPARPSWQydaakrcnqypqgaadpacivgnwNWLGTDDQAR 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15887543 184 DVTARMIYGFRISVLFGLTLTIASALVGVTAGAIQGYFGGWTDLLLQRFIEIWSSMPVLYILLIIAAILPPGFFVLLGIM 263
gi 17988220 169 DVFARALYGFRISVLFGLILTFFSAIIGVTAGAVQGYFGGWVDLLFQRFIEIWSSIPVLYLLLIIAAILPPGFWVLLGIM 248
gi 15644879 128 DVLARLVYGYRVSLIFGILLTLFSVLIGVSLGAFQGYYGGLVDLVGQRLSEIWSAIPMLFLLIVISSAFNSNFWIILFLV 207
gi 15597005 131 DVLARVIYGFRVSILFALTLTVLSSLIGVTVGALQGYYGGWVDLLGQRFLEVWSGLPVLYLLIILASFVQPNFWWLLGIM 210
gi 15597256 130 DVLARVIYGLRLSILFALGLTLASSLLGICAGAVQGYYGGWIDLFGQRFIEVWSGLPMLYLLIILASLVQPGVGWLLAIM 209
gi 17545894 151 DVFARLLYGFRVSVLFGLALTLIGVLVGTLTGALMGFFGGRFDLVSQRLIEVWGSMPELYLLIIFASIFEPSLGLLIVLL 230
gi 15963907 166 DVMARMIYGFRISVLFGLALTIASAVIGVSAGAVQGYFGGWTDLLMQRFIEIWSSMPVLYILLIIAAILPPGFFILLGIM 245
gi 15601348 139 DVLARIIYGFRISVLFGFILTVISSLIGVLIGATQGYYGGWLDLFGQRFIEVWSGMPTLFLLIILSSFVEPNFWWLLGIM 218
gi 15611306 128 DVLARLVYGYRVSLVFGILLTLFSVLIGVSLGAFQGYYGGLVDLVGQRLSEIWSAIPMLFLLIVISSAFNSNFWIILFLV 207
gi 13474579 156 DVLARVIYGFRISVLFGLILTAGSALIGVGAGALQGYFGGWTDLLFQRFIEIWSAIPVLYLLLIVAAILPPGFFILLGLM 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15887543 264 LLFSWVGFVGIVRAEFLRARNFEYVRAARALGVGNWTIMFRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGS 343
gi 17988220 249 LLFSWVAFVGVVRAEFLRARNFEYVNAARALGVKNGTIMWRHLLPNAMVATLTFLPFILNGSITTLTSLDFLGFGLPPGS 328
gi 15644879 208 LLFSWMGLSQVVRTEFLKARNMDYTKAARALGVNDLKIIFYHVLPNALVATITYVPFLMAASISTLVSLDFLGFGMPIGS 287
gi 15597005 211 LLFSWMSLVDVVRAEFLRGRNLEYVRAARALGMRNSAIMFRHILPNAMISTLTFMPFILTGAIGTLTSLDFLGFGLPPGA 290
gi 15597256 210 LLFSWTSLVDVVRAEFLRGRHLEYVKAARTLGLGDAGVMFRHILPNAMVATLTFLPFLLCGAVTTLTALDFLGFGLPPGS 289
gi 17545894 231 SLFGWMSLSAYVRAEFYRNRSLDYVKSARAMGLSDGQIIRRHILPNSLTPIITFLPFNMSAAILTLTSLDFLGLGVPPSM 310
gi 15963907 246 LLFSWVGFVGVVRAEFLRARNFEYVNAARALGVGNGTIMYRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGS 325
gi 15601348 219 VLFSWMSLVGVVRAEFLRCRNFDYVRAAQAMGVSDMRIILRHMLPNAMVASLTMMPFILSGSVTTLTSLDFLGFGLPAGS 298
gi 15611306 208 LLFSWMGLSQVVRTEFLKARNMDYTKAARALGVNDLKIIFYHVLPNALVATITYIPFLMAASISTLVSLDFLGFGMPIGS 287
gi 13474579 236 LLFSWVALVGVVRAEFLRARNFEYVNAARALGVPNRTIMFRHLLPNAMVATLTFLPFLLSGSISTLTSLDYLGFGLPPGS 315
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|.
gi 15887543 344 PSLGEMIAQGKNNLQAPWLGLTAFFTMSIMLSLLIFVGEAVRDAFDPRKTF 394
gi 17988220 329 ASLGELLAQGKNNLQAPWLGITGFVVISAMLSLLIFIGEATRDAFDPRKAF 379
gi 15644879 288 ASLGELVNQGKDNLTTPHLAIVAFVAISLLLSVLVFIGEGVRDAFNANMLK 338
gi 15597005 291 PSLGELVAQGKSNLQAPWLGISAFVVLAVMLSLLVFIGEAARDAFDPRK-- 339
gi 15597256 290 PSLGELVGQGRDNLQAPWLGLTVFVVLATLLSLLVFIGEAVRDAFDPRT-- 338
gi 17545894 311 PSLGELLAQGKANLDAWWISLSTFVTLVLILVLLTFMGDALRDAFDTRLSF 361
gi 15963907 326 PSLGEMIAQGKSNLQAPWLGLTAFFAMSIMLSLLIFVGEATRDAFDPRKTF 376
gi 15601348 299 PSLGELLAQGKANLQAPWLGISAFVVLSVMLTLLVFIGEAVRDAFDPHLQR 349
gi 15611306 288 ASLGELVNQGKDNLTTPHLAVVAFVAISLLLSVLVFIGEGVRDAFNANMLK 338
gi 13474579 316 ASLGELLKQAQRNLNAPWLGISGFVVISLMLSLLVFVGEATRDAFDPRKTF 366
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap