Conserved Protein Domain Family
ModC

?
COG4149: ModC 
ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 226629
View PSSM: COG4149
Aligned: 32 rows
Threshold Bit Score: 185.513
Threshold Setting Gi: 15841326
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
19551464  53 TAPESLGTARLSIGTALFSTALCAIVGFPLALALhlyERSHPRVTSVLTVLVYAPLVLSPVVSGLALTFLWGRRGFLGSW 132 Corynebacterium glu...
14600584  12 LEERFRRSLVLSLGSSTISSVLAVTLATAPAYAM---ARQEGRLTRLISQLHLLLLSIPPVGLGTAALILFTRYPPLNSI 88  Aeropyrum pernix
16124584   1 ----MGEVLWLTAKLAGITTLLLLLLATPLSWWL---ARGRSPLRTPVTAIVALPIVLPPTVLGFYLLIALGPNSPLMAL 73  Caulobacter crescen...
15791669   2 LDPAFLQTLYLTFKLAFITTFILFFIGVFLAYLL---SFVRFPFKTILQSFISLPLILPPSVLGFYLLVTFSANSFLGQV 78  Campylobacter jejuni
15645102   1 MDHEFLITMRLSFSLALITTLILLPVGIFLGYFL---SLKRNLLTSLTETLVYMPLVLPPSVLGFYLLLIFSPSSFLGAF 77  Helicobacter pylori...
15841326  24 TTPSSQTALLLSVKTAAASTVLCVLLGVPMALVL---ARSRGRLVRSLRPLILLPLVLPPVVGGIALLYAFGRLGLIGRY 100 Mycobacterium tuber...
15597059   5 LDSTDLAAIWLTIELASLTTLLLLLIGTPIAWWL---ARTRSWLKGPIGAVVALPLVLPPTVIGFYLLVSMGPNGFIGQL 81  Pseudomonas aerugin...
7387894   43 TTPSSQTALLLSVKTAAASTVLCVLLGVPMALVL---ARSRGRLVRSLRPLILLPLVLPPVVGGIALLYAFGRLGLIGRY 119 Mycobacterium tuber...
15611493   1 MDHEFLITMRLSFSLALITTLILLPIGIFLGYFL---SLKRNLLTSLTETLVYMPLVLPPSVLGFYLLLIFSPSSFLGAF 77  Helicobacter pylori...
16331977   1 -MATDLTPLWISLKTAGLATVVTFILGIAAAYGM---LGDRQPGKSLVEAVFIAPLILPPTVVGFLLLLLFGKNGPLGKI 76  Synechocystis sp. P...
19551464 133 LDQ-VGLPIAFTTTAVVFAQVFVALPFFISTVTTALRGIPKQFEEIAATEGATRWEIMHKMIIPLAMPGIFTGMILGFAR 211 Corynebacterium glu...
14600584  89 SET---LGLFFSPKAVILAQLLVTTPIAVSMLTGVFSMVPRELEEAAEAYGAGRLQILIRIVLPLSLPGILSALAVTFFR 165 Aeropyrum pernix
16124584  74 LQPfGVRTLAFTFEGLVIGSLIYSLPFAVQPLRNAFLAIGDEPLEAAASLGASRAETFWRVALPLALPGYVAAAILTFAH 153 Caulobacter crescen...
15791669  79 LKEyFNLSLVFSFEGLVFASLIFSLPFMVNPLQSAFSSINPNLLDASYSLGKSKIYTLFRVILPNSKAGIFSACAMSFAH 158 Campylobacter jejuni
15645102  78 LQDvLNVKLVFSFQGLILGSVIFSLPFMVSPIKSALISLPASLKEASYSLGKGEYYTLFFVLLPNIKPSLLMAIITTFTH 157 Helicobacter pylori...
15841326 101 LEA-AGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEVVAATLGARPGTVWWRVTLPLLLPGVVSGSVLAFAR 179 Mycobacterium tuber...
15597059  82 TQSlGLGTLPFTFAGLVVGSVFYSLPFVVQPLQNAFEAIGEKPLEAAATLRASPVDRFFSVVLPLARPGFVTAAILGFAH 161 Pseudomonas aerugin...
7387894  120 LEA-AGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEVVAATLGARPGTVWWRVTLPLLLPGVVSGSVLAFAR 198 Mycobacterium tuber...
15611493  78 LQDvLNVKLVFSFQGLILGSVIFSLPFMVSPIKSALISLPTSLKEASYSLGKGEYYTLFFVLLPNIKPSVLMAIITTFMH 157 Helicobacter pylori...
16331977  77 LAQ-FDVTIVFTWYAAVITATVVSFPLMYKTTLGAFEQVDRHLLQVAQTLGASRGEVFRRILLPLSLPGILAGTTLAFAR 155 Synechocystis sp. P...
19551464 212 ALGEYGATLTFAGNIAGVTRTIPLHIELGLSSNDMDKALGAVIMLLAVYVLIIGAIGALRLFSKVRKV 279 Corynebacterium glutamicum ATCC...
14600584 166 ALGEFGATLVLAGNIPGRTETLPLALYNAISLADVETASAIYTLVLAVGLVTLGVHTLLYTRLVKRTG 233 Aeropyrum pernix
16124584 154 TVGEFGVVMMLGGNIPGETTVLSTEIYRLVEALEWGEAHRLSLLLLAFAFLVLFVLLALEARSKILLR 221 Caulobacter crescentus CB15
15791669 159 TVGEFGVVMMIGGHKQGETLVASIAIYDELEILNYSLAHQYAFILFIFSFLVLFSLYFINKKMS-FQ- 224 Campylobacter jejuni
15645102 158 TIGEFGVVMMLGGDILGETRVASIAIFNEAEALNYSKAHQYALTLTLISFSLLFVTLFLNKKQSSFL- 224 Helicobacter pylori 26695
15841326 180 SLGEFGATLTFAGSRQGVTRTLPLEIYLQRVTDPDAAVALSLLLVVVAALVVLGVGARTPIGTDTR-- 245 Mycobacterium tuberculosis CDC1551
15597059 162 TVGEFGVVLMIGGNIPEKTRVVSVQIFDHVEAMEYAQAHWLAGGMVAFSFVVLLALYSGRRRRPGWA- 228 Pseudomonas aeruginosa PA01
7387894  199 SLGEFGATLTFAGSRQGVTRTLPLEIYLQRVTDPDAAVALSLLLVVVAALVVLGVGARTPIGTDTR-- 264 Mycobacterium tuberculosis
15611493 158 TIGEFGVVMMLGGDILGETRVASITIFNEAEALNYSKAHQYALTLTLISFSLLFVTLFLNKKQSSFL- 224 Helicobacter pylori J99
16331977 156 SLGEFGATLMVAGNIPGQTQTIPMAIYFAVEAGAMGEAWLWVGIILVISLAGIMAANIWQRRYEDkih 223 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap