Conserved Protein Domain Family
PanF

?
COG4145: PanF 
Na+/panthothenate symporter [Coenzyme transport and metabolism]
Statistics
?
PSSM-Id: 226625
View PSSM: COG4145
Aligned: 10 rows
Threshold Bit Score: 461.466
Threshold Setting Gi: 15595159
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498674   1 MIIEAVLIGYLAVVLLIGIYE----YRKTRGLLDYYLAGKKLGTLVVSFSFFATYFSTAAFLGGGGTGFLLGFQWsAFLT 76
gi 15595159   1 -----------------------------MLLNKYFLANRNINFIVMALLFSSSYISASSFISGPSAVYKYGLSF-ILLA 50
gi 15833384   5 LEVILPLVAYLVVVFGISVYAmr-kRSTGTFLNEYFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 82
gi 19704020   4 ILIIIPIIIYLVTMLLIAYKVnnikNSSKSFTNEYYLGSRSMGGFVLAMTIVATYVGASSFIGGPGIAYNLGLGW-VLLA 82
gi 1172009    3 LGIILPLIIYLTFVFGAAIFAyv-kRTKGDFLTEYYVGNRSMTGFVLAMTTASTYASASSFVGGPGAAYKYGLGW-VLLA 80
gi 15602954   3 YSILIPLFLYLCFVFAVAYYAya-kRQKGSFLSEYYVGNRSMSGFVLAMTTAATYVGASSFIGGPGAAYKFGLGW-VLLA 80
gi 16766677   3 LEVILPLVAYLVVVFGVSIYAmr-kRTAGTFLNEYFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 80
gi 16123799   3 TDVVLPLVGYLVLVFGLSIYAyt-rRQTGNFLNEYFIGNRSMGGFVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 80
gi 15803792   5 LEVILPLVAYLVVVFGISVYAmr-kRSTGTFLNEYFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 82
gi 16131146   5 LEVILPLVAYLVVVFGISVYAmr-kRSTGTFLNEYFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498674  77 FFHVLFAILAWMVIAPPMKRIADEYGALTIPELFRKR-AGVFSQIVAAVVIIFFFELYMVSIYKGAGNLLQVMLSMDYTT 155
gi 15595159  51 TIQIPTTLIVFIIVGQRLNRESKKINAINIIDYIRHRyESDFLALMSGFVLIFFSMFLISAQLIGGAKLIEVFWGIDYVV 130
gi 15833384  83 MIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARyQSRLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYET 162
gi 19704020  83 CIQVPTAFFTLGVLGKKLSIISRKLNAITIFDVLKARyNNSFLNVLASIMLIVFFISAIVAQFIGGARLFEAVTGLSYLT 162
gi 1172009   81 MIQVPVVWLALGALGKKFALLSRETNALTINDLFFYRyKNKYLVWLSSLALLLAFFAAMTVQFIGGARLLETTIGISYTQ 160
gi 15602954  81 MIQVPVVLFTLGVLGKKFAMWAREHKSLTINDILFSRyKSPTIVLLASLSLLFSFFIMMAVQFIGVGRLLETTLNIDYRL 160
gi 16766677  81 MIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARyQSRLLVWLASLSLLVAFIGAMTVQFIGGARLLETAAGIPYET 160
gi 16123799  81 MIQLPAVWLSLGVLGKKFAILARRYNAVTLNDMLYARyQSRLLVWLASISLLVAFVGAMTVQFIGGARLLETAAGIPYDT 160
gi 15803792  83 MIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARyQSRLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYET 162
gi 16131146  83 MIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARyQSRLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYET 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498674 156 GLVITAVIVMVYTAIGGFRAVVMTDLIQGVIVLIGGVALFLTLIYSLGGFSSAIEALSNakifgemvgkalFEIGKVGPP 235
gi 15595159 131 GLTFFAFLVFIYVFFGGFKAVAYTDLIQGFLMLVSSVILFSKMLDLGGGINNLFKTATSs-----------LDKSLLLPS 199
gi 15833384 163 GLLIFGISIALYTAFGGFRASVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVQTLQT------------IDPQLVTPQ 230
gi 19704020 163 GLIIFSSVVIIYTTFGGFRAVTLTDAIQAVVMFTATTVLFVVILKNGNGMENIMMKIKD------------IDPNLLRPD 230
gi 1172009  161 ALLLFALTVGIYTFIGGFRAVVLTDTIQGTVMIFGTIILLIGTIYALGGVESAVNKLTE------------IDPDLVTPY 228
gi 15602954 161 SVLIFATTVGIYTFIGGFRAVVLTDTIQGLIMMIGTFLLLFGVIYAGGGVSQIIDTLET------------IDPRLITPY 228
gi 16766677 161 GLLIFGVSIALYTAFGGFRASVLNDTLQGLVMLVGTIVLLVGVIHAAGGLSQAVDTLHA------------LDPKLVTPQ 228
gi 16123799 161 GLLIFGISIALYTSFGGFRASVLNDALQGLVMLIGTILLLVAVIHAAGGLHKAVETLQH------------IDPALVSPQ 228
gi 15803792 163 GLLIFGISIALYTAFGGFRASVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVQTLQT------------IDPQLVTPQ 230
gi 16131146 163 GLLIFGISIALYTAFGGFRASVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVQTLQT------------IDPQLVTPQ 230
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498674 236 PIVKaGMIVPFVLSLTFAISVAQLASPQLVVRFVAARDSRVIANGMILTPLIIGIFAICVFSIGPFGWLVIPKYTDdvtq 315
gi 15595159 200 NADL---KPQYIISFWILIGIGILGQPQIINNFIAFKDENAIKFSLPISTFIISFLIVLMHLIGFFAIILFPDLSP---- 272
gi 15833384 231 GADD-ILSPAFMTSFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVIPDLTV---- 305
gi 19704020 231 SGGN--IAKPFIMSFWILVGIGILGLPATTIRCMAFKDTKAMHNAMIIGTSLVGILVLGMHLVGVMGRAVIPDLQE---- 304
gi 1172009  229 GPNG-MLDFQFMASFWILVCFGVVGLPHTAVRCMAFKDSKALHRGMLIGTIVLSIIMLGMHLAGALGRAVIPNLTV---- 303
gi 15602954 229 GIEArPLDFTFMASFWVLVCFGLLGLPHTVIRAMSYKNSKALHSGIVIGTVVIALLMLGMHLAGALGRAVVPELSV---- 304
gi 16766677 229 GADD-ILSPAFMTSFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVLPDLTV---- 303
gi 16123799 229 GGDQ-ILDVPFMASFWILVCFGVIGLPHTAVRCISYRDSKAVHRGIILGTIVVAILMFGMHLAGALGRAVLPDLKI---- 303
gi 15803792 231 GADD-ILSPAFMTSFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVIPDLTV---- 305
gi 16131146 231 GADD-ILSPAFMTSFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVIPDLTV---- 305
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498674 316 flkdVDLVVPFIAMKLFPAGINALLLTAIIAAAMSTINSLIHLVATAFVRDLVQNV---KKIEERTALNLTRFAVFIFAT 392
gi 15595159 273 ----NDKVVLNVALKVLNPFSCFMFFIGLLSAIMSTVDSNLLLITSVLIKSIFIYKe--DLKEDVKIGRIIMISNIFFIL 346
gi 15833384 306 ----PDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIrpdQMQNETRLKRMSAVITLVLGA 381
gi 19704020 305 ----VDKIIPILALKNLYPILAGVFIGGPLAAAMSTVDSLLIISSSTLIKDLYVTYl-dKNTSESKIKKISMCTSFLIGI 379
gi 1172009  304 ----SDQVIPTLMIKVLPPIVAGIFLAAPMSAIMSTIDAQLIQSSSIFVKDLYLSAkpeAAKNEKKVSYFSSIITLILTA 379
gi 15602954 305 ----TDKIIPTLMIQVLPPVVAGIFLAAPMAAIMSSIDSMLIQASSTLIKDLYLRFkpeQIRNERRVKILSTVATLFMTI 380
gi 16766677 304 ----PDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNLrpdQMQNEIRLKRMSAAITLLLGA 379
gi 16123799 304 ----PDQVIPTLMITVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIVKDLYLNLwpaELKNERKLARISSLSTLILGL 379
gi 15803792 306 ----PDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIrpdQMQNETRLKRMSAVITLVLGA 381
gi 16131146 306 ----PDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIrpdQMQNETRLKRMSAVITLVLGA 381
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498674 393 IPVIFAINPMGVIVEIVGVSFSVITSAFLVPLIACLYSEKPNSAAISASMVAAVLASVLWYFYYYKVYWIYPVVPGLLVS 472
gi 15595159 347 IILIFSLFPPNFLFFINIFAFGALEVSFFPIIVFGLYLNFVSKIAAFASMFLGLIFYLSILFFGLNIWFFHPVFPSFFVS 426
gi 15833384 382 LLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAKGALSAMIVGGVLYAVLATLNIQYLGFHPIVPSLLLS 461
gi 19704020 380 LVFILSIKPISLIAWVNLFALGGQEIVFFCPLILGLYWKGANATGAIASIFAGIATYLTLEILKTKIFALHNIVPGLVVA 459
gi 1172009  380 LLIFAALNPPDMIIWLNLFAFGGLEAAFLWVIVLGIYWDKANAYGALSSMIIGLGSYILLTQLGIKLFNFHQIVPSLVFG 459
gi 15602954 381 LVTVATLNPPDMLIWLNLFALGGLETTFLWVMLLGLYWQKANAYGAVCSMIVGLGSYVTLTAASIKLLDFHAIVPALLFG 460
gi 16766677 380 LLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAAGALSAMIVGGVLYALLATFNIQYLGFHPIVPALLLS 459
gi 16123799 380 LLLLAAWRPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAHGALSAMIVGAVCYTVLASFDIKIAGLHPIVPSLTLN 459
gi 15803792 382 LLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAKGALSAMIVGGVLYAVLATLNIQYLGFHPIVPSLLLS 461
gi 16131146 382 LLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAKGALSAMIVGGVLYAVLATLNIQYLGFHPIVPSLLLS 461
                       490
                ....*....|....*....
gi 11498674 473 IAVFAAFSLAFpqPSKAEA 491
gi 15595159 427 IFTFLVVNFFC--KKNSKV 443
gi 15833384 462 LLAFLVGNRFG--TSVPQA 478
gi 19704020 460 IIVFIVASYFG--KKSDEK 476
gi 1172009  460 LIAFLVGNKLGe-RRIEKT 477
gi 15602954 461 LIAFLIGNQYGe-RKIQH- 477
gi 16766677 460 LLAFLIGNRFG--SSASQA 476
gi 16123799 460 LLAFYIGNLFGdrARARHP 478
gi 15803792 462 LLAFLVGNRFG--TSVPQA 478
gi 16131146 462 LLAFLVGNRFG--TSVPQA 478
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap