Conserved Protein Domain Family
PanF

?
COG4145: PanF 
Na+/panthothenate symporter [Coenzyme transport and metabolism]
Statistics
?
PSSM-Id: 226625
View PSSM: COG4145
Aligned: 10 rows
Threshold Bit Score: 461.466
Threshold Setting Gi: 15595159
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11498674   1 MIIEAVLIGYLAVVLLIGIYE----YRKTRGLLDYYLAGKKLGTLVVSFSFFATYFSTAAFLGGGGTGFLLGFQWsAFLT 76  Archaeoglobus fulgidus
15595159   1 -----------------------------MLLNKYFLANRNINFIVMALLFSSSYISASSFISGPSAVYKYGLSF-ILLA 50  Lyme disease spiroc...
15833384   5 LEVILPLVAYLVVVFGISVYAmr-kRSTGTFLNEYFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 82  Escherichia coli O1...
19704020   4 ILIIIPIIIYLVTMLLIAYKVnnikNSSKSFTNEYYLGSRSMGGFVLAMTIVATYVGASSFIGGPGIAYNLGLGW-VLLA 82  Fusobacterium nucle...
1172009    3 LGIILPLIIYLTFVFGAAIFAyv-kRTKGDFLTEYYVGNRSMTGFVLAMTTASTYASASSFVGGPGAAYKYGLGW-VLLA 80  Haemophilus influenzae
15602954   3 YSILIPLFLYLCFVFAVAYYAya-kRQKGSFLSEYYVGNRSMSGFVLAMTTAATYVGASSFIGGPGAAYKFGLGW-VLLA 80  Pasteurella multocida
16766677   3 LEVILPLVAYLVVVFGVSIYAmr-kRTAGTFLNEYFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 80  Salmonella typhimur...
16123799   3 TDVVLPLVGYLVLVFGLSIYAyt-rRQTGNFLNEYFIGNRSMGGFVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 80  Yersinia pestis
15803792   5 LEVILPLVAYLVVVFGISVYAmr-kRSTGTFLNEYFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 82  Escherichia coli O1...
16131146   5 LEVILPLVAYLVVVFGISVYAmr-kRSTGTFLNEYFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGW-VLLA 82  Escherichia coli K12
11498674  77 FFHVLFAILAWMVIAPPMKRIADEYGALTIPELFRKR-AGVFSQIVAAVVIIFFFELYMVSIYKGAGNLLQVMLSMDYTT 155 Archaeoglobus fulgidus
15595159  51 TIQIPTTLIVFIIVGQRLNRESKKINAINIIDYIRHRyESDFLALMSGFVLIFFSMFLISAQLIGGAKLIEVFWGIDYVV 130 Lyme disease spiroc...
15833384  83 MIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARyQSRLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYET 162 Escherichia coli O1...
19704020  83 CIQVPTAFFTLGVLGKKLSIISRKLNAITIFDVLKARyNNSFLNVLASIMLIVFFISAIVAQFIGGARLFEAVTGLSYLT 162 Fusobacterium nucle...
1172009   81 MIQVPVVWLALGALGKKFALLSRETNALTINDLFFYRyKNKYLVWLSSLALLLAFFAAMTVQFIGGARLLETTIGISYTQ 160 Haemophilus influenzae
15602954  81 MIQVPVVLFTLGVLGKKFAMWAREHKSLTINDILFSRyKSPTIVLLASLSLLFSFFIMMAVQFIGVGRLLETTLNIDYRL 160 Pasteurella multocida
16766677  81 MIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARyQSRLLVWLASLSLLVAFIGAMTVQFIGGARLLETAAGIPYET 160 Salmonella typhimur...
16123799  81 MIQLPAVWLSLGVLGKKFAILARRYNAVTLNDMLYARyQSRLLVWLASISLLVAFVGAMTVQFIGGARLLETAAGIPYDT 160 Yersinia pestis
15803792  83 MIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARyQSRLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYET 162 Escherichia coli O1...
16131146  83 MIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARyQSRLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYET 162 Escherichia coli K12
11498674 156 GLVITAVIVMVYTAIGGFRAVVMTDLIQGVIVLIGGVALFLTLIYSLGGFSSAIEALSNakifgemvgkalFEIGKVGPP 235 Archaeoglobus fulgidus
15595159 131 GLTFFAFLVFIYVFFGGFKAVAYTDLIQGFLMLVSSVILFSKMLDLGGGINNLFKTATSs-----------LDKSLLLPS 199 Lyme disease spiroc...
15833384 163 GLLIFGISIALYTAFGGFRASVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVQTLQT------------IDPQLVTPQ 230 Escherichia coli O1...
19704020 163 GLIIFSSVVIIYTTFGGFRAVTLTDAIQAVVMFTATTVLFVVILKNGNGMENIMMKIKD------------IDPNLLRPD 230 Fusobacterium nucle...
1172009  161 ALLLFALTVGIYTFIGGFRAVVLTDTIQGTVMIFGTIILLIGTIYALGGVESAVNKLTE------------IDPDLVTPY 228 Haemophilus influenzae
15602954 161 SVLIFATTVGIYTFIGGFRAVVLTDTIQGLIMMIGTFLLLFGVIYAGGGVSQIIDTLET------------IDPRLITPY 228 Pasteurella multocida
16766677 161 GLLIFGVSIALYTAFGGFRASVLNDTLQGLVMLVGTIVLLVGVIHAAGGLSQAVDTLHA------------LDPKLVTPQ 228 Salmonella typhimur...
16123799 161 GLLIFGISIALYTSFGGFRASVLNDALQGLVMLIGTILLLVAVIHAAGGLHKAVETLQH------------IDPALVSPQ 228 Yersinia pestis
15803792 163 GLLIFGISIALYTAFGGFRASVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVQTLQT------------IDPQLVTPQ 230 Escherichia coli O1...
16131146 163 GLLIFGISIALYTAFGGFRASVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVQTLQT------------IDPQLVTPQ 230 Escherichia coli K12
11498674 236 PIVKaGMIVPFVLSLTFAISVAQLASPQLVVRFVAARDSRVIANGMILTPLIIGIFAICVFSIGPFGWLVIPKYTDdvtq 315 Archaeoglobus fulgidus
15595159 200 NADL---KPQYIISFWILIGIGILGQPQIINNFIAFKDENAIKFSLPISTFIISFLIVLMHLIGFFAIILFPDLSP---- 272 Lyme disease spiroc...
15833384 231 GADD-ILSPAFMTSFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVIPDLTV---- 305 Escherichia coli O1...
19704020 231 SGGN--IAKPFIMSFWILVGIGILGLPATTIRCMAFKDTKAMHNAMIIGTSLVGILVLGMHLVGVMGRAVIPDLQE---- 304 Fusobacterium nucle...
1172009  229 GPNG-MLDFQFMASFWILVCFGVVGLPHTAVRCMAFKDSKALHRGMLIGTIVLSIIMLGMHLAGALGRAVIPNLTV---- 303 Haemophilus influenzae
15602954 229 GIEArPLDFTFMASFWVLVCFGLLGLPHTVIRAMSYKNSKALHSGIVIGTVVIALLMLGMHLAGALGRAVVPELSV---- 304 Pasteurella multocida
16766677 229 GADD-ILSPAFMTSFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVLPDLTV---- 303 Salmonella typhimur...
16123799 229 GGDQ-ILDVPFMASFWILVCFGVIGLPHTAVRCISYRDSKAVHRGIILGTIVVAILMFGMHLAGALGRAVLPDLKI---- 303 Yersinia pestis
15803792 231 GADD-ILSPAFMTSFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVIPDLTV---- 305 Escherichia coli O1...
16131146 231 GADD-ILSPAFMTSFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVIPDLTV---- 305 Escherichia coli K12
11498674 316 flkdVDLVVPFIAMKLFPAGINALLLTAIIAAAMSTINSLIHLVATAFVRDLVQNV---KKIEERTALNLTRFAVFIFAT 392 Archaeoglobus fulgidus
15595159 273 ----NDKVVLNVALKVLNPFSCFMFFIGLLSAIMSTVDSNLLLITSVLIKSIFIYKe--DLKEDVKIGRIIMISNIFFIL 346 Lyme disease spiroc...
15833384 306 ----PDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIrpdQMQNETRLKRMSAVITLVLGA 381 Escherichia coli O1...
19704020 305 ----VDKIIPILALKNLYPILAGVFIGGPLAAAMSTVDSLLIISSSTLIKDLYVTYl-dKNTSESKIKKISMCTSFLIGI 379 Fusobacterium nucle...
1172009  304 ----SDQVIPTLMIKVLPPIVAGIFLAAPMSAIMSTIDAQLIQSSSIFVKDLYLSAkpeAAKNEKKVSYFSSIITLILTA 379 Haemophilus influenzae
15602954 305 ----TDKIIPTLMIQVLPPVVAGIFLAAPMAAIMSSIDSMLIQASSTLIKDLYLRFkpeQIRNERRVKILSTVATLFMTI 380 Pasteurella multocida
16766677 304 ----PDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNLrpdQMQNEIRLKRMSAAITLLLGA 379 Salmonella typhimur...
16123799 304 ----PDQVIPTLMITVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIVKDLYLNLwpaELKNERKLARISSLSTLILGL 379 Yersinia pestis
15803792 306 ----PDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIrpdQMQNETRLKRMSAVITLVLGA 381 Escherichia coli O1...
16131146 306 ----PDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIrpdQMQNETRLKRMSAVITLVLGA 381 Escherichia coli K12
11498674 393 IPVIFAINPMGVIVEIVGVSFSVITSAFLVPLIACLYSEKPNSAAISASMVAAVLASVLWYFYYYKVYWIYPVVPGLLVS 472 Archaeoglobus fulgidus
15595159 347 IILIFSLFPPNFLFFINIFAFGALEVSFFPIIVFGLYLNFVSKIAAFASMFLGLIFYLSILFFGLNIWFFHPVFPSFFVS 426 Lyme disease spiroc...
15833384 382 LLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAKGALSAMIVGGVLYAVLATLNIQYLGFHPIVPSLLLS 461 Escherichia coli O1...
19704020 380 LVFILSIKPISLIAWVNLFALGGQEIVFFCPLILGLYWKGANATGAIASIFAGIATYLTLEILKTKIFALHNIVPGLVVA 459 Fusobacterium nucle...
1172009  380 LLIFAALNPPDMIIWLNLFAFGGLEAAFLWVIVLGIYWDKANAYGALSSMIIGLGSYILLTQLGIKLFNFHQIVPSLVFG 459 Haemophilus influenzae
15602954 381 LVTVATLNPPDMLIWLNLFALGGLETTFLWVMLLGLYWQKANAYGAVCSMIVGLGSYVTLTAASIKLLDFHAIVPALLFG 460 Pasteurella multocida
16766677 380 LLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAAGALSAMIVGGVLYALLATFNIQYLGFHPIVPALLLS 459 Salmonella typhimur...
16123799 380 LLLLAAWRPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAHGALSAMIVGAVCYTVLASFDIKIAGLHPIVPSLTLN 459 Yersinia pestis
15803792 382 LLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAKGALSAMIVGGVLYAVLATLNIQYLGFHPIVPSLLLS 461 Escherichia coli O1...
16131146 382 LLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERANAKGALSAMIVGGVLYAVLATLNIQYLGFHPIVPSLLLS 461 Escherichia coli K12
11498674 473 IAVFAAFSLAFpqPSKAEA 491 Archaeoglobus fulgidus
15595159 427 IFTFLVVNFFC--KKNSKV 443 Lyme disease spirochete
15833384 462 LLAFLVGNRFG--TSVPQA 478 Escherichia coli O157:H7
19704020 460 IIVFIVASYFG--KKSDEK 476 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
1172009  460 LIAFLVGNKLGe-RRIEKT 477 Haemophilus influenzae
15602954 461 LIAFLIGNQYGe-RKIQH- 477 Pasteurella multocida
16766677 460 LLAFLIGNRFG--SSASQA 476 Salmonella typhimurium LT2
16123799 460 LLAFYIGNLFGdrARARHP 478 Yersinia pestis
15803792 462 LLAFLVGNRFG--TSVPQA 478 Escherichia coli O157:H7 EDL933
16131146 462 LLAFLVGNRFG--TSVPQA 478 Escherichia coli K12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap