Conserved Protein Domain Family
YnjD

?
COG4136: YnjD 
ABC-type uncharacterized transport system YnjBCD, ATPase component [General function prediction only]
Statistics
?
Aligned: 5 rows
Threshold Bit Score: 351.057
Threshold Setting Gi: 15963821
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15963821  14 GCLTLSEVT-IGLGGRALLA-ISATIAPGEVLTIMGPSGSGKSTLLAFAGGFLDPAFDVSGRILIDGKDLTAVPANRRHA 91  Sinorhizobium meliloti
15831716   1 -MLCVKNVS-LRLPESCLLTnVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAGQFSCTGELWLNEQRIDMLPTAQRQI 78  Escherichia coli O1...
15641670   1 MIFSLENLAiLKQDGHCLLAeFNLTIAEGEIVSLMGPSGCGKSTLLSVIAGHLATDFTFQGSMKLGDTQLNTLPAHQRQV 80  Vibrio cholerae
15802167   1 -MLCVKNVS-LRLPESCLLTnVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAGQFSCTGELWLNEQRIDMLPTAQRQI 78  Escherichia coli O1...
13634052   1 -MLCVKNVS-LRLPESRLLTnVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGELWLNEQRIDILPTAQRQI 78  Escherichia coli
15963821  92 GILFQDPLLFPHLSVGGNIVFAIAPDVKGRgARRRLADAALDEVGLAGFFDRDPDTLSGGQKARVALQRVLVSAPRFLLL 171 Sinorhizobium meliloti
15831716  79 GILFQDALLFDQFSVGQNLLLALPATLKGN-ARRNAVNDALERSGLDGAFHQDPATLSGGQRARVALLRALLAQPKALLL 157 Escherichia coli O1...
15641670  81 GMLFQDDWLFPHLNVWENLAFALPNSIKGE-QRKKNAYAALTKIALTELACSFPEQISGGQRARISLMRMLLAEPKLVLL 159 Vibrio cholerae
15802167  79 GILFQDALLFDQFSVGQNLLLALPATLKGN-ARRNAVNDALERSGLDGAFHQDPATLSGGQRARVALLRALLAQPKALLL 157 Escherichia coli O1...
13634052  79 GILFQDALLFDQFSVGQNLLLALPATLKGN-ARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLL 157 Escherichia coli
15963821 172 DEPFSNLDAALRQQTRELVFSKARAAGLPTILVTHDSADAEaAGGRVIEIGMEEQA 227 Sinorhizobium meliloti
15831716 158 DEPFSRLDVALRDNFRQWVFSEVRELAIPVVQVTHDLQDVP-ADSSVLDMAQWSEN 212 Escherichia coli O157:H7
15641670 160 DEPFSKLDKALRSQFRDWVFNQLTSAGIPTLMVTHDHEDVP-VGSRVIEWPVIEQE 214 Vibrio cholerae
15802167 158 DEPFSRLDVALRDNFRQWVFSEVRELAIPVVQVTHDLQDVP-ADSSVLDMAQWSEN 212 Escherichia coli O157:H7 EDL933
13634052 158 DEPFSRLDVALRDNFRQWVFSEVRALAIPVVQVTHDLQDVP-ADSSVLDMAQWSEN 212 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap