Conserved Protein Domain Family
YnjD

?
COG4136: YnjD 
ABC-type uncharacterized transport system YnjBCD, ATPase component [General function prediction only]
Statistics
?
PSSM-Id: 226620
View PSSM: COG4136
Aligned: 5 rows
Threshold Bit Score: 351.057
Threshold Setting Gi: 15963821
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15963821  14 GCLTLSEVT-IGLGGRALLA-ISATIAPGEVLTIMGPSGSGKSTLLAFAGGFLDPAFDVSGRILIDGKDLTAVPANRRHA 91
gi 15831716   1 -MLCVKNVS-LRLPESCLLTnVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAGQFSCTGELWLNEQRIDMLPTAQRQI 78
gi 15641670   1 MIFSLENLAiLKQDGHCLLAeFNLTIAEGEIVSLMGPSGCGKSTLLSVIAGHLATDFTFQGSMKLGDTQLNTLPAHQRQV 80
gi 15802167   1 -MLCVKNVS-LRLPESCLLTnVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAGQFSCTGELWLNEQRIDMLPTAQRQI 78
gi 13634052   1 -MLCVKNVS-LRLPESRLLTnVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGELWLNEQRIDILPTAQRQI 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15963821  92 GILFQDPLLFPHLSVGGNIVFAIAPDVKGRgARRRLADAALDEVGLAGFFDRDPDTLSGGQKARVALQRVLVSAPRFLLL 171
gi 15831716  79 GILFQDALLFDQFSVGQNLLLALPATLKGN-ARRNAVNDALERSGLDGAFHQDPATLSGGQRARVALLRALLAQPKALLL 157
gi 15641670  81 GMLFQDDWLFPHLNVWENLAFALPNSIKGE-QRKKNAYAALTKIALTELACSFPEQISGGQRARISLMRMLLAEPKLVLL 159
gi 15802167  79 GILFQDALLFDQFSVGQNLLLALPATLKGN-ARRNAVNDALERSGLDGAFHQDPATLSGGQRARVALLRALLAQPKALLL 157
gi 13634052  79 GILFQDALLFDQFSVGQNLLLALPATLKGN-ARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLL 157
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 15963821 172 DEPFSNLDAALRQQTRELVFSKARAAGLPTILVTHDSADAEaAGGRVIEIGMEEQA 227
gi 15831716 158 DEPFSRLDVALRDNFRQWVFSEVRELAIPVVQVTHDLQDVP-ADSSVLDMAQWSEN 212
gi 15641670 160 DEPFSKLDKALRSQFRDWVFNQLTSAGIPTLMVTHDHEDVP-VGSRVIEWPVIEQE 214
gi 15802167 158 DEPFSRLDVALRDNFRQWVFSEVRELAIPVVQVTHDLQDVP-ADSSVLDMAQWSEN 212
gi 13634052 158 DEPFSRLDVALRDNFRQWVFSEVRALAIPVVQVTHDLQDVP-ADSSVLDMAQWSEN 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap