Conserved Protein Domain Family
HsdR

?
COG4096: HsdR 
Type I site-specific restriction endonuclease, part of a restriction-modification system [Defense mechanisms]
Statistics
?
PSSM-Id: 226581
View PSSM: COG4096
Aligned: 12 rows
Threshold Bit Score: 876.385
Threshold Setting Gi: 15900424
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
730887    248 TDQAIK---RTLNLSEEESR-FLIDAQLRKAGWQADSKTLRFSKGARPEPGVNKAIAEWPTGKDetgn-qgfADYVLFVG 322  Escherichia coli
15834562    1 MAELN-----LSNLTEADIItKCVMPAILNAGWDNTTQIRQEVKLRDGKVIVRGKVAARRTVKS--------ADIVLYHK 67   Escherichia coli ...
20090950    1 --------mKMLDLNEFQTRkLKIDILLKEQGWDVNDRSKVVLEVDTKQSDFKKQDYKQVNETRrndaeskyADYLLLDS 72   Methanosarcina ac...
20090965    1 ---------MSDNQTPEQKArNEIDKKLNNAGWIVQ------KKSKIEWSASRGIAVKEYLTDVg------pADYVLFVD 59   Methanosarcina ac...
20091249  195 STLLPDt--HDYSEAETRKS--LIDLLLKEAGWP-------LDKTQDKEFEVLGMPNKNGVGYV---------DYVLWGD 254  Methanosarcina ac...
17548111   13 ATRRPD---VAASESQTAACgDAIDRLLHAAGWP-------LTGPDDTAFPLAGLPTPPGKAYV---------DYVLWDD 73   Ralstonia solanac...
15900424    1 MVEFIK---SKKEMSEEDIKaNFITPAIVSKGWKNGEHIAYEEYFTDGRIEVRGDKARRKEGKK--------SDYSLYYQ 69   Streptococcus pne...
15900775  163 AAQRQDvpfHIDQLSEAETRkLFIDIDLRLAGWI-------FEENCRVEIAVDGLKHGSGIGYC---------DYVLYGK 226  Streptococcus pne...
16767770  229 TDQAVK---RTLELNEEESR-FLIDAQLRKAGWQADSKTLRFAKGARPEPGVNKAIAEWPTGTDetgk-tgfADYVLFIG 303  Salmonella typhim...
15804922    1 MAELN-----LSNLTEADIItKCVMPAILNAGWDNTTQIRQEVKLRDGKVIVRGKVAARRTVKS--------ADIVLYHK 67   Escherichia coli ...
17230965    1 MSEAID----KKSLSERDICtKYITPALVNRGWNINTQIREEVTLTKGRVIVRGKLTSRGEQKR--------ADYVLYHK 68   Nostoc sp. PCC 7120
17231110    1 MSEVID----KKSLSERDICtKFITPALTNRGWNISTQIREEVTLTKGRVIVRGKLTSRGEQKR--------ADYVLYHK 68   Nostoc sp. PCC 7120
730887    323 -LKPIAVVEAKRNN--IDVPARLNESYRYSKCFDNGFLretllehyspdevheavpeyetswqdtsgkqrfkIPFCYSTN 399  Escherichia coli
15834562   68 pGIPLAVIEAKANK--HEIGKGMQQGIEYARLLD--------------------------------------VPFVFATN 107  Escherichia coli ...
20090950   73 tGKPLAIIEAKRTT--KDPILGQKQAEEYADDIKAQTGk---------------------------------EVFIFLSN 117  Methanosarcina ac...
20090965   60 -KKPVGIIEAKRDEegHRLTAVEEQSSEYASSKLKYLNnd-------------------------------pLPFVYEST 107  Methanosarcina ac...
20091249  255 dGKPLALVEAKRTT--KDPQVGQQQAKLYANCLENQFGq---------------------------------RPVIFYSN 299  Methanosarcina ac...
17548111   74 rRKPLAIVEARHTR--RNTRAGQQRARQYADGLEALTGq---------------------------------RPLIYYTN 118  Ralstonia solanac...
15900424   70 fGTRIAIVEAKDNK--HSVRAGLQQAIEYGEILD--------------------------------------VPFVYSSN 109  Streptococcus pne...
15900775  227 nGKILAIVEAKKAS--VNPEVGEVQVKEYAEALEKHIGy---------------------------------QPICFITN 271  Streptococcus pne...
16767770  304 -LKPIAVVEAKRKN--TDVSSKLNESYRYSKYFDNGFLrdtllehyapdevhdavpeyeiswqdtsgkqrfkIPFCYSTN 380  Salmonella typhim...
15804922   68 pGIPLAVIEAKANK--HEIGKGMQQGIEYARLLD--------------------------------------VPFVFATN 107  Escherichia coli ...
17230965   69 pGVPLAVIEAKDNN--HSVSAGMQQAIATGELID--------------------------------------VPFIFSSN 108  Nostoc sp. PCC 7120
17231110   69 pGVPLAVIEAKDNN--HSVSAGMQQAIATGELID--------------------------------------VPFIFSSN 108  Nostoc sp. PCC 7120
730887    400 GREYRATMKTKSGiwyrdvrdtrnMSKALPEWHRPEELLEMLGSEPQKQN-QWFADNPGMSELGLRYYQEDAVRAVEKAI 478  Escherichia coli
15834562  108 GDGFIFRDATAAEgeclekqitldDFPSPAELWQKFCLWKGYTQAQLPVI-TQDYYDDG-SGKSPRYYQLQAINKTIEAV 185  Escherichia coli ...
20090950  118 GYQIWLWDRERYG-------------PRQLKGFYSLKDLERLLYQRKNS--ELEAEIDIDGSIVDRAKSIEVATRVVEHI 182  Methanosarcina ac...
20090965  108 GEITRFTDFRDPK-----------PRSRPVFSFFSPETFDEYLKKKPLR--ERLLDIPELLTDGLRDCQITAISKLEKSF 174  Methanosarcina ac...
20091249  300 GYETWIWDDSLYP-------------PRQVQGFYKKAELELLIQRRSSR--RPLSEAEINSAIVERYYQTRAIRRIGEAF 364  Methanosarcina ac...
17548111  119 GRDHWFWDDRAGP-------------PRAVQGFHRQDELERLLGCRTHR--QPLATAAIDTAIAGRPYQHRAIRRIAEAF 183  Ralstonia solanac...
15900424  110 GDGFIEHDRITREerel----eldEFPTREELFSRMTKEKGLTYEITEAI-STPYYTDAFSMKTPRYYQQIAINRTIETV 184  Streptococcus pne...
15900775  272 GLKHYILDGPNRR---------------QIAGFYSQEELQLVMDRRHLQKpLEDISSKIRDDISGRHYQKHAIASVCEAF 336  Streptococcus pne...
16767770  381 GREYRAAMKTKSGiwyrdvrhttnMSKALPEWHRPEELLDMLGSDPQKQN-QWFAENPGMSELGLRYYQEDAVRAVEQAI 459  Salmonella typhim...
15804922  108 GDGFIFRDATAAEgeclekqitldDFPSPAELWQKFCLWKGYTQAQLPVI-TQDYYDDG-SGKSPRYYQLQAINKTIEAV 185  Escherichia coli ...
17230965  109 GDAFMMCDCTVTDgqrer-eipldQFPTPEKLWQKYCDWKGIDTDIQPIV-SQDYYPSP-DKKQPRYYQQIAINRTIEAI 185  Nostoc sp. PCC 7120
17231110  109 GDAFMMCDCTVTEgqrer-eiplnQFPTPEELWQKYCDWKGIDLHIQPIV-AQDYYPSP-DKKQPRYYQQIAINRTIEAI 185  Nostoc sp. PCC 7120
730887    479 VKGQQE-ILLAMATGTGKTRTAIAMMFRLIQSQRFKRILFLVDRRSLGEQALGA-FEDTRINGDTFNSIFDIKGLTdkf- 555  Escherichia coli
15834562  186 SNGQNR-VLLVMATGTGKTYTAFQIIWRLWKSKNKKRILFLADRNILVDQTK---NNDFQPFGTAMTKVSGRTIDP---- 257  Escherichia coli ...
20090950  183 HKGHRK-ALIVMATGTGKTRVAMAIIDQLIREGRVQRVLFLTDRKALRKQAYEKgYLRFFPEETKEIILSGNYNSN---- 257  Methanosarcina ac...
20090965  175 KDNRPR-ALVQMATGSGKTYTAITFIYRLLKFADAKKVLFLVDTKNLGEQAEQE-FMAYVPNDDNRKFTELYNVQRlrss 252  Methanosarcina ac...
20091249  365 EQDNDRkALIVMATGAGKTRTVIALCDLLMRCNWVKRVLFLADRVALVNQAVNA-FKRHLPDSAPVNLVTEKDTEG---- 439  Methanosarcina ac...
17548111  184 EQDRLRaALVSMAPGTGKTRTAIALTELLMRCRWIKRTLFLADRTAQLTRAAAA-FAAHLPQATLVNLAKDAGADG---- 258  Ralstonia solanac...
15900424  185 ARGQKR-VMFVMATGTGKTFMAFQIIHRLRKAGLAKRVLFLADRNILVDQTM---AEDFRPFEKVMTKITPKLLTApek- 259  Streptococcus pne...
15900775  337 SDHRRQ-ALLVMATGAGKTRTAVSLVDILSRHNWVKNVLFLADRTSLVKQAYDS-FRKLLPDLSVCNFLEDKEGAQ---- 410  Streptococcus pne...
16767770  460 VNGQQH-ILLAMATGTGKTRTAIALMFRLIQSQRFKRVLFLVDRRSLGEQALGA-FEDTRINGDTFNSIFDIKGLTdkf- 536  Salmonella typhim...
15804922  186 SNGQNR-VLLVMATGTGKTYTAFQIIWRLWKSKNKKRILFLADRNILVDQTK---NNDFQPFGTAMTKVSGRTIDP---- 257  Escherichia coli ...
17230965  186 AKGENR-ILLVMATGTGKTFTAFQIIWRLWKSGAKKRILFLADRNILVDQTR---VNDFKPFGSKMTKIKQRQIDT---- 257  Nostoc sp. PCC 7120
17231110  186 AKGENR-ILLVMATGTGKTFTAFQIIWRLWKSGAKKRILFLADRNILVDQTR---VNDFKPFGSKMTKIKQRQIDT---- 257  Nostoc sp. PCC 7120
730887    556 -pedSTKIHVATVQSLVKRTLQS------------------------DEPMPVAR--YDCIVVDEAHRGYILDKEqtege 608  Escherichia coli
15834562  258 ----AYEIHLALYQAITGPEEDQ------------------------KAFKQVAPdfFDLIVIDECHRGSASEDSaw--- 306  Escherichia coli ...
20090950  258 -----CRLYVSTIQTFQEIYNQKd----------------------rNEMYRISPgaFDLIFSDEAHRSIYSKWK----- 305  Methanosarcina ac...
20090965  253 yissDSQVCISTIQRIYSILKGEeldekieeenpaergwqpreplpvVYNEKVPVeeFDFIVIDECHRSIYNLWQ----- 327  Methanosarcina ac...
20091249  440 ------RVFVSTYPTMMKQIEEIn-----------------------GGQRRFGVghFDLVIIDEAHRSVFKKYR----- 485  Methanosarcina ac...
17548111  259 ------DVYLSTCPTMQDRIAHPi-----------------------DTVPRFGPghFDLVIVNIAHRGICRRHR----- 304  Ralstonia solanac...
15900424  260 --lnSFEIYLGLYQQLTGEDGTE------------------------THYQKFDKdfFDLIVIDEAHRGSAKENSnw--- 310  Streptococcus pne...
15900775  411 ----SSRMVFSTYPTMIGAISGQe----------------------eVNQRPFTVghFDLIIIDESHRSIYQKYK----- 459  Streptococcus pne...
16767770  537 -pedSTKIHVATVQSLVKRTLQS------------------------DEPMPVGR--YDCIVVDEAHRGYILDKEqtege 589  Salmonella typhim...
15804922  258 ----AYEIHLALYQAITGPEEDQ------------------------KAFKQVAPdfFDLIVIDECHRGSASEDSaw--- 306  Escherichia coli ...
17230965  258 ----SYEIYLCLYQAVTGNEEAK------------------------NIYRQFSPgfFDLIIIDECHRGSASEDSaw--- 306  Nostoc sp. PCC 7120
17231110  258 ----SYEIYLCLYQAVTGNEEAK------------------------NIYRQFSPgfFDLIIIDECHRGSASEDSaw--- 306  Nostoc sp. PCC 7120
730887    609 lqfrSQLDYVSAYRRILdhfdavKIALTATPALHTVQIF----GEPVYRYTYRTAVIDGFLIDq-DPPIQIITRNAQEGV 683  Escherichia coli
15834562  307 ---rEILDYFSSATQIGl-----TATPKETHEVSSTDYF----GDPVYVYSLKEGIEDGFLAP--YKVVRVDIDVDLQGW 372  Escherichia coli ...
20090950  306 ----GIFTYLDAIQIGL------TATPADMVDRDTFRFFecndDIPTALYSYEDAVRDAVLCDfrKNISGARTYFQIEGI 375  Methanosarcina ac...
20090965  328 ----QVLDYFDAFLIGL------TATPDK----RTFGFFn---ENVVSEYSHEDAVADGVNVG--YDVYTIETEISKNGA 388  Methanosarcina ac...
20091249  486 ----AIFDYFDSLLVGL------TATPKNEIERNTYSLFdlepGVPTDAYQLEEAVKDGFLVP--PKAVSVPLKFQRQGI 553  Methanosarcina ac...
17548111  305 ----AIFSHFDALRVGL------TAMPEDEIDRDTYRLFdletGIPTDAYDLDEAIADHHLVP--PRAVCVPVRQPRGGM 372  Ralstonia solanac...
15900424  311 ---rKVIDYFSSATQIGm-----TATLKETKNASNTEYF----GEPIYTYSLKQGIEDGFLAP--YRVMRVNLDVDVDGY 376  Streptococcus pne...
15900775  460 ----SIFDYFDARIVGL------TATPRQDLDKNTYGFFnlenGVPTYAYDLEEAVKDGYLVA--YHSIETKLKLPTDGL 527  Streptococcus pne...
16767770  590 lqfrSQLDYVSAYRRILdhfdavKIALTATPALHTVDIF----GEPVYRYTYRTAVIDGYLIDq-DPPIQIVTRNAQDGV 664  Salmonella typhim...
15804922  307 ---rEILDYFSSATQIGl-----TATPKETHEVSSTDYF----GDPVYVYSLKEGIEDGFLAP--YKVVRVDIDVDLQGW 372  Escherichia coli ...
17230965  307 ---rDILAYFSSATQIGl-----TATPRETEEVSNSLYF----GDSIFTYSLKQGIEDGFLAP--YKVIRIDFDTDLSGW 372  Nostoc sp. PCC 7120
17231110  307 ---rDILAYFSSATQIGl-----TATPRETEEVSNSLYF----GDSIFTYSLKQGIEDGFLAP--YKVIRIDFDTDLSGW 372  Nostoc sp. PCC 7120
730887    684 YLSKGEq-vERISPQGEVINDtleDDQDFEVADFNRGLVIPAFNRAVCNELTNYLDP------TG--SQKTLVFCVTNAH 754  Escherichia coli
15834562  373 RPTKG-----QTDLNGEVI-----DDRIYNQKDFDRTMVIDERTELVARTITDYLKR------TNp-MDKTIVFCNDIDH 435  Escherichia coli ...
20090950  376 KPENLTe-gEREELIKKGIDP---DEINFEGTELEKKIAVKGTSEAIVREFMENCLTd----qAGtlPAKTIFFAISKLH 447  Methanosarcina ac...
20090965  389 KIAAKEfvdKREKLTRKKRWEqldEEFNYDARKLDRDVVNPSQIRHVIRTFKEKLTEif---pGRkeVPKTLIFAKNDSH 465  Methanosarcina ac...
20091249  554 NYDELS---DEDKEQWEALDWgdeDGEIPERVEAEAVNKWLFNKDTVDKVLAHLMERglk-vaGGdrLGKTILFAKNQAH 629  Methanosarcina ac...
17548111  373 AYDALS---DAEKDHGDALEWn-dNGHANTAVP-DTADACLHHQDTVDAMIALVMEKrgrrvaDGdwIGKTLIFASNHDH 447  Ralstonia solanac...
15900424  377 RPETG-----KVDANGQLI-----EDRYYGRKDFDKTIVIDDRTQRVAKFVSDYMKQ------NNarFDKTIVFCVDIDH 440  Streptococcus pne...
15900775  528 HYDDLS---EEEKEHFDSKFE---DNSCEKDIDGSVFNSFIFNKSTVEIVLNELMTRgiq-taSGdeIGKTIIFAKNHDH 600  Streptococcus pne...
16767770  665 YLSEGEq-vERLNPQGELINDtlaDDQDFEVADFNRGLVIPAFNRAVCGELTKYLDP------TG--QQKTLVFCVTNAH 735  Salmonella typhim...
15804922  373 RPTKG-----QTDLNGEVI-----DDRIYNQKDFDRTMVIDERTELVARTITDYLKR------TNp-MDKTIVFCNDIDH 435  Escherichia coli ...
17230965  373 KPKPG-----QRDKYGKEI-----PDQVFNQRDFDRTLVLEKRTELVARIISDYLKS------SDr-FAKTIVFCETTDH 435  Nostoc sp. PCC 7120
17231110  373 KPKPG-----QRDKYGKEI-----PDQVFNQRDFDRTLVLEKRTELVARIISDYLKS------SDr-FAKTIVFCETTDH 435  Nostoc sp. PCC 7120
730887    755 ADMVVEELRAAFKKkypqLEHDAIIKITGDADKDARKVQTMITrfnKERLPNIVVTVDLLTTGVDIPSICNIVFLRKVRS 834  Escherichia coli
15834562  436 AERMRRALVNLNPEqv-kKNDKYVMKITGDDEIGKAQLDNFINp--KKPYPVIATTSELMTTGVDAKTCKLVVLDQNIQS 512  Escherichia coli ...
20090950  448 AKRLWEAFEKLYPE----YKGKLARIIVSEDSRAQQLIKDFEE----KPFPRIAISVDMMDTGIDVPEVCNLVFAKPVFS 519  Methanosarcina ac...
20090965  466 ADDIINVVREEFAE----GN-AFCKKVTYKAEEDPKSILSAFR---NEYDPRIAVTVDMIATGTDVKPLECLLFMRDVKS 537  Methanosarcina ac...
20091249  630 AEYVAERFNVNYPH----FKGEFARVITFKTEYAQSLIDNFSI---KEKDPHIALSVDMLDTGIDVPEVVNLVFFKLVRS 702  Methanosarcina ac...
17548111  448 ARFIAGRFDANYPQ----YKGRLACVITYEAGQAQTLIDAFSV---ADRMPRVAIAAGLLDTGIAVPEVVNLVFFRLVRS 520  Ralstonia solanac...
15900424  441 AERMRAALVKENLDlv-qEDYRYVMQVTGDNAEGKAQLDNFMDv--NSNFPAIVTTSKLLTTGVNAKTCRLIVLDSNIQS 517  Streptococcus pne...
15900775  601 AEYIRGIFNNRYPE----KGSDYAQVIDYSIKHYQTLIDDFKI---KEKYPQIAISVDMLDTGIDVPEVVNLVFFKKVRS 673  Streptococcus pne...
16767770  736 ADMVVDELRSAFKKkypqLEHDAIIKITGDADKDAKKVQSMIVrfnKERLPNIVVTVDLLTTGVDIPSICNIVFLRKVKS 815  Salmonella typhim...
15804922  436 AERMRRALVNLNPEqv-kKNDKYVMKITGDDEIGKAQLDNFINp--KKPYPVIATTSELMTTGVDAKTCKLVVLDQNIQS 512  Escherichia coli ...
17230965  436 AERMRVALVNENADlm-aENSRYIMRITGDDAQGKAELDNFIDp--ESKYPTIVTTSELLTTGVDAKTCKLIVLDQRILS 512  Nostoc sp. PCC 7120
17231110  436 AERMRVALVNENADlm-aENSRYIMRITGDDAQGKAELDNFIDp--ESKYPTIVTTSELLTTGVDAKTCKLIVLDQRILS 512  Nostoc sp. PCC 7120
730887    835 RILYEQMKGRATRLCPEVN-----------KTSFKIFDCVDIYSTLESVDTMRPVVVRPKVELQTLVNEITDSETYKITE 903  Escherichia coli
15834562  513 MTKFKQIIGRGTRIDERYG-----------KLWFTILDFKKAT--------------------ELFADERFDGIPEKVMD 561  Escherichia coli ...
20090950  520 KIKFWQMLGRGTRADGACEhrewl--pdgkKEYFKVFDFWNNFEYWNMNPEGVQNESAEAITNRIFLTRLKQLGELMQHR 597  Methanosarcina ac...
20090965  538 RNYFEQMKGRGTRTLGYDDlkkvtpsavsdKTHFVVVDAVGVTKTMKTDSRPLE-RKKSTSLKDLLAAVTFGAQDEDLYV 616  Methanosarcina ac...
20091249  703 KTKFWQMVGRGTRLCPDLFepg------edKRFFYLFDYCQNLEFFSQNPETTEGALGDSLGTRLFKSRLELLSELDKKL 776  Methanosarcina ac...
17548111  521 KARFRQMVGCGTRPCKNLYgpg------qdKQDVLLFDFCQNLAFFDMRLEAAAETMPVPLEQRLFRARLELLARLETRP 594  Ralstonia solanac...
15900424  518 MTEFKQIIGRGTRLYPQKG-----------KEFFTIIDFRNVT--------------------NLFADPDFDGDPVKVLE 566  Streptococcus pne...
15900775  674 KTKFWQMIGRGTRLCKDLFgpe------qdKENFLVFDYGDNFDYFRADPRDGEGRHIVSLTQRLFNIKVDLIRELQGLQ 747  Streptococcus pne...
16767770  816 RILYEQMKGRATRLCPSVG-----------KTSFKIFDCVDIYSSLESVDTMRPVVVRPQVELQTLVNEITDSETYKTIE 884  Salmonella typhim...
15804922  513 MTKFKQIIGRGTRIDERYG-----------KLWFTILDFKKAT--------------------ELFADERFDGIPEKVMD 561  Escherichia coli ...
17230965  513 MTKFKQIVGRGTRIDEDYG-----------KMFFTIIDFKKAT--------------------QLFADPEFDGEPVQIYQ 561  Nostoc sp. PCC 7120
17231110  513 MTKFKQIVGRGTRIDEDYG-----------KMFFTIIDFKKAT--------------------QLFADPEFDGEPVQIYQ 561  Nostoc sp. PCC 7120
730887    904 ADGRSFAEHSHEQ-------LVAKLQRIIGLATFNRDRS-ETIDKQVRRLD-------------ELCQDAAGVNFNGFAS 962  Escherichia coli
15834562  562 T--TPEDIADPES-------DFEEKLEEI--SEHDDEQV-TGVDEPPAPPY-------------QVKDTDDVGPLPEEDE 616  Escherichia coli ...
20090950  598 DPASEKAAEQVK----------AKIISDIESLPRDSVNVrEHLQDVEKALSpk----------lWDNIAVDPVEFLQKKI 657  Methanosarcina ac...
20090965  617 SLANRLARLDRQLs--------DDERVTFAEKANGKTINqTVRDLLYAYNPd-----------iIDLHASEIKQLHPEIQ 677  Methanosarcina ac...
20091249  777 EADSDCEVGTETReiygepiTEAEVRHSIAETLHSEIAS-MNLDNFVVRPKrrlverysrseawLKLSGEDLSELSHEVA 855  Methanosarcina ac...
17548111  595 AGLSVREAGASygn----ppTPAALHDDVAQWLHRQVAS-MSTDNFAVRAKhrhiapyvhreawQRLGPAQAAELSEHVC 669  Ralstonia solanac...
15900424  567 TGAKTVSGSTPG-----------------------------FVDEEGD-------------------------------- 585  Streptococcus pne...
15900775  748 YQEDQFARAYRQQ-------LVSELQGRIESLNELDFRVrMVLDTVYSYRKle---------swQNLTAVTSETIQKNLS 811  Streptococcus pne...
16767770  885 ADGRSFAEHSHEQ-------LVAKLQRIIGLAIYNRDRS-EAVDKQVRRLD-------------ELCLDAAGVNFGGLAS 943  Salmonella typhim...
15804922  562 T--TPEDIADPES-------DFEEKLEEI--SEHDDEQV-TGVDEPPAPPY-------------QVKDTDDVGPLPEEDE 616  Escherichia coli ...
17230965  562 P--KPVDPIVPP--------------------DNGDDEV-IIDGEITR-------------------------------K 587  Nostoc sp. PCC 7120
17231110  562 P--KPVDPIVPP--------------------DNGDDEV-IIDGEITR-------------------------------K 587  Nostoc sp. PCC 7120
730887    963 RLREKGPHWSAEVFNKLPGFIARLEKLKTDINNLNDAPIFlDIDDEVVSV--KSLYGDYDTPQDFLEAFDSLVQRSPNAQ 1040 Escherichia coli
15834562  617 KKIRKFHVNGVAVG----VIAQRVQYYDADGKLVTES-----FKDYTR----KTLLKEYASLDDFTRKWQDADRKEAIIH 683  Escherichia coli ...
20090950  658 MPLMKFKPDVNLKEATFTLRCEKLAYALLENDKAEIDRLKtSIAEMVDRl--PRTLDSVRAKEALMDNVLSRSFWETVSF 735  Methanosarcina ac...
20090965  678 DAEAKKKAQEKLIDIARSTFSGELNEYIENVRRVHEQIIDtVNTDTVHRa--EWDKDAVVRADELVSDFKTYLEANKEEI 755  Methanosarcina ac...
20091249  856 GLPSEMEPEAEEAKR-FDLLVLNLQLALLRAEPAFERLRN-QVRDIAGLLeeKSAIPMVRDQMALILDVQTDEWWENVTT 933  Methanosarcina ac...
17548111  670 GLPTTLLDDSDEAARRFDLLMLRLQLCVLRGESAPGHLKR-PVRGVARALlaQTGLPAVHDQAGWIQAIAEEGWWDDASV 748  Ralstonia solanac...
15900424  586 -PVEKYIVTDKQVT----ILNSTVQVLDENGKLITES-----LTDYTR----KNILGSYATLNDFITVWHTADKKKLILD 651  Streptococcus pne...
15900775  812 PLLFDEDKEDEMARR-FDLWLLHIQLGQLTAKSSTVHIS--QVMKTARALsaIGNIPQVFEQAEIIRKVQEPEFWKEVNL 888  Streptococcus pne...
16767770  944 RLREKGPHWSAEIFNKLPGFIARLERLTTDINALREAPIFlDIDDEVVSV--KSLYGDYDTPQDFLEAFDALVQHAPNAQ 1021 Salmonella typhim...
15804922  617 KKIRKFHVNGVAVG----VIAQRVQYYDADGKLVTES-----FKDYTR----KTLLKEYASLDDFTRKWQDADRKEAIIH 683  Escherichia coli ...
17230965  588 QKREKYVIADEEVS----VAFIREQYHGKDGKLITES-----IKDYTR----KTVSQEYASLDAFLKKWHSTEQKQAIIQ 654  Nostoc sp. PCC 7120
17231110  588 QKREKYVIADEEVS----VAFIREQYHGKDGKLITES-----IKDYTR----KTVSQEYASLDAFLKKWHSTEQKQAIIQ 654  Nostoc sp. PCC 7120
730887   1041 PALQAVINRPRDLTRKGLVELQEWFDRQHFEESSLRKAWKETRNEDIAArlIGHIRRAAVGDALKPFE-ERVDHALTRIK 1119 Escherichia coli
15834562  684 ELEQQGI--IWEVLAEEVG---KDLDPFDMLCHVVYGQPPLTRKERAEN-----VRKRNYFTKYSEAA-QAVLDNL--LD 750  Escherichia coli ...
20090950  736 EDVQLLLSDLAPLMPYMAKE-PRETIVIDMSDIIAERKEWQISGGNDPSy-VEAYRREVEACIRALAEtHPAVRKIKNNE 813  Methanosarcina ac...
20090965  756 TALRIFYNQPYQRREVTFTMIKEVLDKLKLEKPHFAPFRIWKAYEQLEK-----VNGNSPKNELTALV--SLIRRITEID 828  Methanosarcina ac...
20091249  934 PMLETLRRRLRDIVKLIEKHRRKPIY-TDFEDEMGSENNVELPGFAAAGd-FEKFRAKTRAFLLEHQD-QAVIHKLRMNK 1010 Methanosarcina ac...
17548111  749 LLLEQARRRLRALVHLTDAQTRWQLACTDPTDAPGPASAIATAACADDTs-FARFRTNVCRCLRAHAR-HPTLHKLRHNA 826  Ralstonia solanac...
15900424  652 ELYKKGV--YLDAIRESEGISEQEIDDFDLLLKLAYGQKELTKTERINK-----LKQSGYLYKYSEEA-RAVLEIL--LN 721  Streptococcus pne...
15900775  889 SDLEKIRLAIRDLLQFLDKTDRKPYY-VNFEDRILSTVHETTAFLQVND--LRSYNEKVEHYLKTHLD-EESISKLYHNK 964  Streptococcus pne...
16767770 1022 PALQAVINRPRDLTRKGLVELQEWFDRQHFEESSLRSAWKATRNEDIAArlIGHIRRAAVGDALKPFD-ERVDHALARIK 1100 Salmonella typhim...
15804922  684 ELEQQGI--IWEVLAEEVG---KDLDPFDMLCHVVYGQPPLTRKERAEN-----VRKRNYFTKYSEAA-QAVLDNL--LD 750  Escherichia coli ...
17230965  655 ELQELGV--PLEALEKEIG---KGFDPLDLICHVVFDQPPLTRKERANN-----VRKRNYFSKYSEQA-RKVIDAL--LD 721  Nostoc sp. PCC 7120
17231110  655 ELQELGV--PLEALEKEIG---KGFDPLDLICHVVFDQPPLTRKERANN-----VRKRNYFSKYSEQA-RKVIDAL--LD 721  Nostoc sp. PCC 7120
730887   1120 GENDWSSEQLSWLDR---------------------------LAQALKEKVVLDDDVFKTGN------------------ 1154 Escherichia coli
15834562  751 KYADAGVQEIESIQV---------------------------LKLKPFDSMGTLPEIIKTG------------------- 784  Escherichia coli ...
20090950  814 PLTDYDLEQLEETLLnadltpdnpklsslaslsnlypsrhasLVDFIRQVLGLYSSPAPDALikdafqtyiiennkhyss 893  Methanosarcina ac...
20090965  829 PVLTPYDQTVNRNFQ---------------------------DWVFKKQAGTLKFSEDQMKWlrm--------------- 866  Methanosarcina ac...
20091249 1011 PLTAADLDELERILSesglggpeei--------ahakevsngLGLFVRSLIGLDREAAKQSFarflagktlva------- 1075 Methanosarcina ac...
17548111  827 PLTTADLAGLEQMLAangvgdreai--------drarrasggLGVFVRGLIGLDREAARAALsgaitseamta------- 891  Ralstonia solanac...
15900424  722 KYMDKGIGELESIET---------------------------LKLPEFQIYGGTFKIINTY------------------- 755  Streptococcus pne...
15900775  965 KLTSDDMLALEKLLWeklgskady----------qshyenkaIPRLVREIIGLDRESANRIFskflsdenlna------- 1027 Streptococcus pne...
16767770 1101 AENDWSDEQINWLDR---------------------------LAQALKEKVVLDDDVFKTGN------------------ 1135 Salmonella typhim...
15804922  751 KYADAGVQEIESIQV---------------------------LKLKPFDSMGTLPEIIKTG------------------- 784  Escherichia coli ...
17230965  722 KYADEGIEDIEKLDV---------------------------LKVHPFDKVGTPIEIIQL-------------------- 754  Nostoc sp. PCC 7120
17231110  722 KYADEGIEDIEKLDV---------------------------LKVHPFDKVGTPIEIIQL-------------------- 754  Nostoc sp. PCC 7120
730887   1155 -----------FHRRGGKAMLQRTFDDNLDTLLGKFSDYIWDELA 1188 Escherichia coli
15834562  785 -----------FGDRNGYNQALSELENEIYQLPPRSA-------- 810  Escherichia coli O157:H7
20090950  894 dqlnfiltlqtVFLKKKHIEYSTLWQPPFTNFGTTSPFPMFTQEE 938  Methanosarcina acetivorans C2A
20090965  867 --------ikdYVATSFHLEIEDLDYTPFDALGGRGRMYQLFGDE 903  Methanosarcina acetivorans C2A
20091249 1076 nqiefinriidHLTEHGAMDAALLYESPFTDLTPQGPDGLFTSAQ 1120 Methanosarcina acetivorans C2A
17548111  892 dqcdfidlvvtHLTMHGVMEAARLYASPFTDIAPQGPDSLFAPET 936  Ralstonia solanacearum
15900424  756 -----------FGDKKRYLQAIKELEQELFTVA------------ 777  Streptococcus pneumoniae TIGR4
15900775 1028 rqisfvklivdYIVENGFLETKVLTQEPFKSYGSVQLLFQHQLPV 1072 Streptococcus pneumoniae TIGR4
16767770 1136 -----------FHRRGGKPMLQRTFDDNLDSVLDKFSDYIWDELA 1169 Salmonella typhimurium LT2
15804922  785 -----------FGDRNGYNQALSELENEIYQLPPRSA-------- 810  Escherichia coli O157:H7 EDL933
17230965  755 -----------FGSRKEYLNVLQQLKTQLYEIA------------ 776  Nostoc sp. PCC 7120
17231110  755 -----------FGSRKEYLNVLQQLKTQLYEIA------------ 776  Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap