Conserved Protein Domain Family
VirJ

?
COG3946: VirJ 
Type IV secretory pathway, VirJ component [Intracellular trafficking, secretion, and vesicular transport]
Statistics
?
PSSM-Id: 226455
View PSSM: COG3946
Aligned: 8 rows
Threshold Bit Score: 250.459
Threshold Setting Gi: 15964934
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549740 137 GRFRDVPVYKPTGEVRSVVLMLSGDQGWTSATSrmAQSLAAQGALVAGLSTPALFASLEADLGDCAFPDGDLENFSRFLQ 216
gi 15889787   1 MMKRNLIGAFIAASTLLSSSVAFSQDKPAYETG--MIPADHIMVPDGDIQASIFLISDANGWTEADETRAKALVEKGAAV 78
gi 17989026  16 VCAAGIYASLHSGKIARFWAQLYNADEPVIHASaeRLSNIPVYMPKGDPVGLAILLSDEKGIGDQERSYMDAMLARNIIV 95
gi 15596116   1 ----------------------------------------MSVVKRHWRRFLVAALVLIVGAALLLWSRPAAQAKLEALD 40
gi 15964934   7 ILKRAALAALIAGAASLP-S--FAEDAAKFDTG--MIPAPHILFPKEAASGAVVLLSDAGGWTEREDAVARKLSSEKALV 81
gi 15964935     --------------------------------------------------------------------------------
gi 15837356     --------------------------------------------------------------------------------
gi 15839268   1 MKQFKIRSVLQSIALLVLAGTAAAEPKPEKITHg-RFEQIPVLRPDGEPQRVVIWFSD-AGHVDQRTRQAEILRQDGAMV 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549740 217 AYEKVPGYYPPILVGDNEGGALAYAMIAQARPNIFAAAMSLEFCPVLELrkPLCKGEGVHFSRRMSESRTTAKRVKPKDN 296
gi 15889787  79 VGIDFKEYLKALEADDDECIYMISDIESLSQQIQRTAGTGSYRLPIVTG--IGKGGTLALAMIAQSPVSTVREAVAVDPK 156
gi 17989026  96 MPVELGPWRAALDKEDGECNYLDSDFEAIAKEALRGLDLGVYFHPVLTG--IGQGATIAYAAASDSPDATIAGAVSLDPT 173
gi 15596116  41 LDDGGHATLAEPGEKPRSRVVVIAAPEQQLNDAQMLNLAHDSAARVIQYfpPENGDCRAQQSRLEAVIARLGGKPNLVAG 120
gi 15964934  82 IGIDLKAYLAALGRDDGDCVYTVSDIESLSQQVQRAAGSGAYRPPIVAG--VGAGGAMALAIAAQSPAATIGRTLAVDPE 159
gi 15964935     --------------------------------------------------------------------------------
gi 15837356     --------------------------------------------------------------------------------
gi 15839268  79 ALVDTTHLYKVLAADSNHCTFSVGDVENLSRYLQAYYRDKTYRLPLLVG--DGDGSGLVYAVAAQATENILAGVVSDGLC 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549740 297 AGVVLLPATRLSAPWVALQSGTLTPFARRSGPlcearATQTFIETISGAQSVALPAAQPGAPGSAGVPPVTASEPfkaaf 376
gi 15889787 157 AGLPLEKILCTPATKDKVDGETVYGLTDGALP-----APVSVIFTPDADQ----KGRDHVNALVKLHSDIEVTDVtdkad 227
gi 17989026 174 PARTRLPSCTEKAEAIKGPDGGFTYSVNAALP-----APALLISPPGSPVNNPVEARRKNIAVLQTAPDFSAR------- 241
gi 15596116 121 IGPGSTTAWRWLASQDDDKAKALSVGFDIALAerdcdAPLPHQASHGQWLLAWNDNPDDDTAVFVRKQSSAETSIsdydt 200
gi 15964934 160 EGIALTKQLCTPAEKTRKGDRMVYGLTDGALP-----DPVTVVSSPSASA----AGRERVAALAAKHPDVEVQESdedvy 230
gi 15964935     --------------------------------------------------------------------------------
gi 15837356   1 ------------------------------------------------------------------MPPLPE-------- 6
gi 15839268 157 PVVVPTQAVCG-AGVASDQHLKPAPVAAPLLVmtvssAHCPAQLTSGFVRKVALGREIRLAASADLLPRLRAALR----- 230
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549740 377 AKLNAQRKPPPPPPPAAVSDLPVIEVAAQPGtSSELFAVLLSGDGGWAGLDKEVAAALSKSGVPVVGVDSLRYFWTPRTP 456
gi 15889787 228 EVLTQTLSDKVDAAGDSGNPLGLPITVLEAKpVMDTMAVIYSGDGGWRDLDEEVGSALQKQGVPVIGVDALRYFWKEKDP 307
gi 17989026 242 MKMAVDNVVAMADQDAKNEALPIIDLPAKGG-NADMVAVFYSGDGGWRDIDKSIGEWLQAHGVHVIGVDSLRYFWSERTP 320
gi 15596116 201 PLSDVLAHQLRLQLQGNAEALPVLEVPAAQP--SDIVTLFYSGDGGWRDLDKDSAEHMASMGYPVVGIDTLRYYWQHKSP 278
gi 15964934 231 AALSSTLAGYIQQEDEGDNPFGLP-------------------------------------------------------- 254
gi 15964935   1 ------------------------------------MAVIYSGDGGWRDIDKEVGNALQQQGVPVVGVDSLRYFWSERQP 44
gi 15837356   7 -KVQSHRATPIQS--SGVSALPLVEYHA-PG--SDRLAIMISGDGGWRTLDRNLSKELQRRGISVVGWNSLRYFWKLRTP 80
gi 15839268 231 -VLGAQKGVSLPPPPADLDGLPVVEVPSKAQkKSDTFAIFVSGDGGWAEIDKKVAGHLADADIPVVGLDSLRYFWSERTP 309
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549740 457 ASAAADMDRLVRFYAARWKKTKALLIGYSQGADVLPFIVNRLPAASREHVALAVMMGLGKRADFEFHMTNWVSSSASG-- 534
gi 15889787 308 KEVAGDLARIIDTYRKEWKVKNVVLIGYSFGADIIPATYNLLPDRVKSSVAQLSLLGLSNEVDFEISVQGWLGVAGEGkg 387
gi 17989026 321 EEIANDTTAMIKKADP-TGKLPVAVLGYSFGADTFPFAWKYLDPSIQDRTRMVGLLGVETTTTFQVSIEGWLGMNGDK-- 397
gi 15596116 279 EQSAADLSKLMQHYREKWGAKRFVLAGYSFGADILPAIYNRLPGKDQQQVKAMLLLALARTGSFEIEVEGWLGKAGEEa- 357
gi 15964934     --------------------------------------------------------------------------------
gi 15964935  45 QATADDLARVITYYGRRWNVRNVLLIGYSFGADILPRTYNLLPSATRARVRQVTLMALSHRADYKISVLGWLGADGEGna 124
gi 15837356  81 EQLGDDLSRVIADYQRRWGAHQVILIGYSFGADVMPFAYAHLMPTQRNGVDFISLLALGRKADFKARIFGWLGWGEHGt- 159
gi 15839268 310 EGFAKDLDRIARFYAHHWKRNRLLLVGFSQGADVLPAAINKLSPNTRQIIRMTALLSLGKYAHYEFHVSNWISTDDEG-- 387
                       410       420       430       440       450       460       470
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 17549740 535 LLILPEVQKLPTGLGMCIYGRDEKDSN-CPSLDPKQVQLVKLPGGHHFDGDYAKLARIILEG------ARGP--GVVAR 604
gi 15889787 388 GKTVDDIAKIDPKLVQCVYGTEEEDEDpCPGLKAKGVETIGIEGGHHFDEDYEALAKRIVTSl----kTRLAk------ 456
gi 17989026 398 -DVVPAIASIPLDRVVCVYGQEEDDTA-CTADELKGMDTIKLPGGHHFDENYEPIAAALLDKm----rSRAGlpPRPAR 470
gi 15596116 358 -ATGPEMARLPAAKVFCIYGAEEKDESgCTQSQAVGEK-LELPGGHHFDEDYLSLAKKMLQAi----rDRENapDA--- 427
gi 15964934     -------------------------------------------------------------------------------
gi 15964935 125 GDPVDDIKAIEPALVQCIYGTDEEDDA-CPDLKSSGIDVVSIEGGHHFDGDYAALTRRVLDA------LDRR--LAMGR 194
gi 15837356 160 RDVLTALGALDLHRVQCIYGQNDKDAV-CPELRERIFDVVMRPGGHHFDGDTVKLADAILQGwqrrieLREPrnADSPR 237
gi 15839268 388 IPIAPDMVKLRSTRTVCIYGVDDQETL-CPSLPQQNRR-VALPGTHHFNGDYETVAKTILAQm-----EAAP------- 452
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap