Conserved Protein Domain Family
Spy

?
COG3914: Spy 
Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 226428
Aligned: 7 rows
Threshold Bit Score: 612.939
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17228058   92 ERREelEEYSIAEKIRQSIKEFSPQDIHNLLHLLQLAIKLEIYTGENLQELGIIKLLQSEP---IVDVNLEFLLETLkLV 168  Nostoc sp. PCC 7120
15890993    1 MPQDvmTANHVSPSNDAAAPSALDLARNQRLSLMDLLSVSEALNAAGQQAAAAELYKTWVA---FNDNNPTIHLAYFnYA 77   Agrobacterium tum...
16124374  106 gdaverlekrldpasqppqalldsvvaqyrsgnlaaaesqahaltlsfpnhelgwkvlgavfsvtgrseeslasmrqals 185  Caulobacter cresc...
16125359    1 -------------MADLDTLEMLSKLTADGCSLGDVITLASNLATGGQPALADQAYKIWIK---FNPDHPQLCVALFnRS 64   Caulobacter cresc...
16127948    3 SAREafDLYRAGRTAEAAALCERLVAAAPSVEAWHLLGVAR-LELGAAQA-ALTALDAGLA---LDPVRPGL-LSA--RT 74   Caulobacter cresc...
17228054  260 qyiaddsrypditrqmaavryailsndhtelnrlRNQIAQQWLNIPDEKLAEIYAGLLGKT--------HKVLLAN---S 328  Nostoc sp. PCC 7120
16330340   76 ELNK--NDKQTVLILWQQIIKIVPNYLAGHLNLLVVACELKVFSAEKLAYLGTVALINSIDsgcISQQEEELLLRAT-LS 152  Synechocystis sp....
17228058  169 LYYAPTHPSTLEFVEICLPYCKDNNQALLVTLLPTALELgySQRQFDIAINLCELYLKISPKNTEVMGHLSSLYQnAGQY 248  Nostoc sp. PCC 7120
15890993   78 VMLNQLGDRAGAVQAFRACLKANPEFAPGHINLGRALED--AGLIGHAVEQWSHYAEVTKNVDAETIGHRHMTLQnMGRV 155  Agrobacterium tum...
16124374  186 lnpqdaetfknlailllklkraeeaeaacrsalalapdypqvhltlgnalidlaraaeaeesfrqairlkpdyseahcnl 265  Caulobacter cresc...
16125359   65 VLQAALGDSVAAAASLEQAIQINPEFMPAYVNLGGLQER--AGLQELAIATWEAGANRPIVLNGMGVSYAFTCLKqIARL 142  Caulobacter cresc...
16127948   75 LALTSLHRDDEAVVAARAALAVDPDNPPVFNALAVSLQR--LGGFSEALAAIDH-AVAAAPREAAYRAHR-------AAL 144  Caulobacter cresc...
17228054  329 INDKNFASK-DSILVKDIVISQEFTNCKSIQNLLAAMMLg-DFNRVLLLSDFSQIPEWLLYDYIQFLFPV-------QDY 399  Nostoc sp. PCC 7120
16330340  153 ILEFPTALS-LDFLRSSIPLLVNLPWCDAVMAFANSMVY--DKQLFSYGVEIAEICLQYSPNNLFILNDLIRFYG-LRKD 228  Synechocystis sp....
17228058  249 KKGIETAELFFSLVHDLVDKVFAN-----RQILRGLITAggyWEESCSVNdkqelliksliEDNPTNLNAARISRLFNAN 323  Nostoc sp. PCC 7120
15890993  156 LEGAGKLEEAETALLQAFELRPEL-----PEAGQHWASL---RQRQCKWP-----------VLAPSNHISPRKMLDAMSS 216  Agrobacterium tum...
16124374  266 gcalklsgrlteaetcfrraiqlnpadaqahnnlgdvfkdlgrfadaeafyraaiglkpeyLEAHSNLLLCLNYFETS-- 343  Caulobacter cresc...
16125359  143 LGEMHQPARAELALQRAADIDPKA-----MDVIGQLVAT---RLSQCKWP-----------AVQPTERLSRETLLNGVNP 203  Caulobacter cresc...
16127948  145 LVLLNRPAEAARDLEAVLEVNPSH-----PRVAGDLMWA---RRQTCDWR-----------EDAALDMLVKADLKLGR-- 203  Caulobacter cresc...
17228054  400 FKLLGNTVEYYQYIEKSVYLLHKYi-----------------FQELDSYS-----------SYKATNYFTQIANFIHIY- 450  Nostoc sp. PCC 7120
16330340  229 QDALLRTARNLLNIFRQQDFEPDFgfylsSRLLSAFMTGn-dWEQVQSIAsifkdyfillqNEKSVVLNNFLRDRFWGLG 307  Synechocystis sp....
17228058  324 YFAFYIEDNPSKNRKIQNQLLQICQNNISHLDREIIEKySHghlvrkkQKQINKKLTIGYVSHCMRSHSVGWLARWLVQH 403  Nostoc sp. PCC 7120
15890993  217 LTLSCYADDPMFQLAKAYRLSKTLIGARPDLSRFPRRSpKQ-------KSGTGQRLRVGYLSSDLRDHAVGFALCEVLEL 289  Agrobacterium tum...
16124374  344 -------S-PDTYLAEAKQYGSVAS--AAATPKFSAWS----------IQPEPRRLRVGFISGDLNSHPVGYFSESVFQH 403  Caulobacter cresc...
16125359  204 LSIAAYSDDPLLQLGAANQFIEREAKTTPEQVRADRRD-AP-------IDLAGRRPRIGYISSDLRDHAVGYLMAELFEV 275  Caulobacter cresc...
16127948  204 AGVAPFAALALFDLPVLHRRCATLS--APPSVPAPVWP----------VRRPGERLRVAYLSSDLHEHATARLLAGVLEA 271  Caulobacter cresc...
17228054  451 FNEINLKDVYVKRADIIEQCLKING--HKIDYEFQDRD------------RNRKKIRLGILSAHFTPSAETFAYLPVYEY 516  Nostoc sp. PCC 7120
16330340  308 FSLLYLFDEPESNRRCLNFNASIFQQNLTENQNKTICQeENl-----pKKKQVSLKRIGYIAHTLRQHSVGWLCRWLFKY 382  Synechocystis sp....
17228058  404 HDRDKFQLNAYFLNtNPALDALHEWYLIKVDKTYKSN--EYLQIAEEIYNDEIDILIDLDSITLDT--TCDIIALKPAPI 479  Nostoc sp. PCC 7120
15890993  290 HDKDSLEVFAYYCGnVRGTDSTQERIKAAVHCWRDIHgvDDATAASQIIADEIDILIDVNGYTKDA--RAKIFAYRPAPV 367  Agrobacterium tum...
16124374  404 LDRDRFELFAFPTT--PKTDALTSRISPFFAGWCPIFgmDDHAAATAIHTQGVHVLVDLSGHTADN--RLPVFAFRPAPV 479  Caulobacter cresc...
16125359  276 HDKAKVEVFAYYCG-PESSDGLNTRIRAAAEHFIDIRpmSDDEAAQRIVDDGIDILVDVNGHTRDA--RTAVFARRPAPI 352  Caulobacter cresc...
16127948  272 HDRSRFEIFAVSYG-PETGGAMQERLRAACEHWIEARrlSDAEIALKCRQQGVDIAVDLKGYTQDG--RPGILAHRAAPL 348  Caulobacter cresc...
17228054  517 LSRD-FEVILYSLTeTSHRLEQYCRISANLFKVLPKG---LSDQVNAIRTDDLDILFVATNVTVVTsqICQLAIHRLARI 592  Nostoc sp. PCC 7120
16330340  383 HDREKFEIFVYLIG-QPEDELTENWIYPNVSKYYHFGr-DKNEIIKQIKQDQIQILVDLDVLTHNI--TAQVLAHKPAPV 458  Synechocystis sp....
17228058  480 QITWLGWDASGS-PSIDYFIADPYVLP-ESAQEYYTERIWRLP---QTYIGVDGFEVGVPT-VRRDQLDIPDDAVVYFCG 553  Nostoc sp. PCC 7120
15890993  368 IVSFCGYPGSMGsPFHQYLISDGYMIP-PENEIYYSEKVLRIA----CDQPLDRKRPVAAR-PSRADVGLPEDAFVYASF 441  Agrobacterium tum...
16124374  480 QASWLGYFATTGlPEMDYFLGDRYMVT-ETEQQRFTETLWRLPetwLCLAPHERSIPINPP------PVLTNGFMTFGCL 552  Caulobacter cresc...
16125359  353 LVNWLGYPGTMGsDYHHYIVGDPWIIP-PEMELYYSEAVRRIP----CYQPNDRRRIVASDvPTRTEAGLPEDGFVFCCF 427  Caulobacter cresc...
16127948  349 QVSWLGYPGTLG-AHADVVLADAVTLP-PGAETNWSEAVVRLP----CYQPNDGLTSVIPA-PSRADMGLPERVRVFCCF 421  Caulobacter cresc...
17228054  593 QITSGASVATTGmRNMDYYISGTLTDPsPTAQEQYQEKLIKLEgtaHCFSYGTEEGKLTTP-VERNSLGIPGNAVVFISG 671  Nostoc sp. PCC 7120
16330340  459 QVSWLGSDASGL-PAIDYFIVDPYVVP-DDAEGYYREKLWRLP---QTYLAVDGFEMGTPT-LSREQLGIKPNTVIYLSV 532  Synechocystis sp....
17228058  554 QRGFKRHPDITRLQLQIIKEVPNSYFLIKGIS-------DEESIKNFFEELAEEEGVDYSRLRFLPIVATEs--VHRANL 624  Nostoc sp. PCC 7120
15890993  442 NGMQKITENCFARWMTILSETPGSLLWLLTG---------DDDVNQRLRDLAEKSGVASERLVFAPKAQNP---QHIARI 509  Agrobacterium tum...
16124374  553 GNLSKMNGEVVALWSQILRAVPESKLLLKAKPf------VDAQVVADIQARFAREGVSSDRLILEGPSSRA---EYFETY 623  Caulobacter cresc...
16125359  428 NGTQKITPHVFDRWMEILKRTSGSVLWLLDS---------NPETNARLRDAAEARGVDRMRLVFAPKMPNA---FHLARY 495  Caulobacter cresc...
16127948  422 NNPAKITPEVFATWMAILRAAPDSVLWLYAG---------APGAADNLRGHARAAGVAPERLVFAEPAPHE---AHLARH 489  Caulobacter cresc...
17228054  672 ANYFKTVPELMDTWAKIISIVPNSVLVLLPFGpnwssnyPKAEFINHLNSIFSRHGLGTERLRVLDPQPVPdreDMKEYY 751  Nostoc sp. PCC 7120
16330340  533 QNKIKSNPNILKLQLQILQSVPDSVFLIKGGG-------DNELIRAMVEQLAKEMGLDLHRIRFLPKDGDEm--THRANL 603  Synechocystis sp....
17228058  625 GIADIVLDTYPYNGATTTLETLWMCIPMVTKVGEQFAARNSYTMMMNAGITEGIAWTDEEYVEWGVRLGKDEALRQQIAW 704  Nostoc sp. PCC 7120
15890993  510 GLADLFLDTFPYGAHSTASDAITSGLPVLTMYGKTFAARFCGSIVTAAGVPEMICSSPEDYVARAIGFERDRQSLLEVRE 589  Agrobacterium tum...
16124374  624 NRIDLVLDTFPYPGGTTSVDALWMGVPVLTLAGDRFLARLGESIARNAGQSAWVARDRADYLAKAVAFASVR-DVAHDRP 702  Caulobacter cresc...
16125359  496 RLADLFLDTTPYGAHTTASDALWMAVPVLTWSGRSFASRVCGSLVRSAGLPELVVDSAAAYVEKAVEIGSDRARAQALRA 575  Caulobacter cresc...
16127948  490 VLADLVLDTWPYGAHTTASDALRMGVPVLTLPGESFASRVGASLATAIGMTELIATSRADYVAKALAMAADG--ALKPRV 567  Caulobacter cresc...
17228054  752 KIADVYLDSYPFAGTTSLIEPLQVNLPVIARQGSCFRSAMGAAIIQTLNIPDLVADSEDSYIELAVALGNNSALRQQKSA 831  Nostoc sp. PCC 7120
16330340  604 SIADVVLDTYPYNGATTTLETLWMEVPLVTRVGKQFASRNSYTFLTQLNIREGLAWNDQEYVYWGTRFGLEKSLREKVKN 683  Synechocystis sp....
17228058  705 KLKQSRKTSP-LWNGKQFTREMEKAYTQMWEIYMS 738  Nostoc sp. PCC 7120
15890993  590 SIARQRETSV-LRDIPALARRLEELFWQMQGECER 623  Agrobacterium tumefaciens str. C58 (Cereon)
16124374  703 ALRRSVLTTP-LFDPERFARDFGDTLWGMWSQGRS 736  Caulobacter crescentus CB15
16125359  576 TLEANRDTCV-LFDMDLLADKLETLYGEMIAEYQA 609  Caulobacter crescentus CB15
16127948  568 AEAVRRSN---LFDPVAFARSLETVYAGLVRR--- 596  Caulobacter crescentus CB15
17228054  832 EIKEKMQSNPsFLDSRSYSAKMGSLFQELFSDYIA 866  Nostoc sp. PCC 7120
16330340  684 ELNLGKYKSK-LWRAKDFTQELELAYEGMWNGDLD 717  Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap