Conserved Protein Domain Family
AddB

?
COG3857: AddB 
ATP-dependent helicase/DNAse subunit B [Replication, recombination and repair]
Statistics
?
PSSM-Id: 226375
View PSSM: COG3857
Aligned: 8 rows
Threshold Bit Score: 976.516
Threshold Setting Gi: 15615543
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113346      1 MGAEFLVGRSGSGKT--KLIINSIQDELRRApfgKPIIFLVPDQMTFLMEYELAKTPDMGG---MIRAQVFSFSRLAWRV 75   Bacillus subtilis
15615543    1 MAEQVVYESTVKEIAnrKRLTHWFQWQQMTG---TPLYYILPSAKWLS-----LGRKRQPG------IRYITFDDLAELI 66   Bacillus halodurans
15895531    1 MSLRFIYGRAGSGKS--QFCIESINTRIEKGg-dKPLILIVPEQFSFQSEKNILDLIGEKS---INRVKVISFKRLAYRI 74   Clostridium aceto...
15671985    1 --MEILYTEITQDLT--EGLLEISLEELEKN---RKVYYIVPSSMSFEKEKEILERLAKGSdsaVFDLLVTRFKQLPYYF 73   Lactococcus lacti...
15926555    1 MTLHAYLGRAGTGKS--TKMLTEIKQKMKADplgDPIILIAPTQSTFQLEQAFVNDPELNG---SLRTEVLHFERLSHRI 75   Staphylococcus au...
15901016    1 --MKLLYTDIRTSLT--EILTREAEELVAAG---KRVFYIAPNSLSFEKERAVLEYLSQQA---SFSITVTRFAQMARYL 70   Streptococcus pne...
15674821    1 --MKLIYTEMSYSMT--EILVNEARKAADQG---YRVFYIAPNSLSFEKEREVLTLLPERG---TFSIIVTRFVQMSRYF 70   Streptococcus pyo...
16801432    1 MTLQIIAGKAGTGKT--THLMDEVGEKIKKTs--KTYIFIVPDQMTFQMETSFLNKQNLAG---MLGTQIFSFSRLAWKI 73   Listeria innocua
113346     76 LQHTGGMSRPFLTSTGVQMLLRKLIEEH-KQEFKVYQKASDKSGFTAQVERMLTEFKRYCLEPEDIRRMAESGTASeyrg 154  Bacillus subtilis
15615543   67 LDET-KESYVAIGEEDRHLFFQQFLEED------ALGGTHDR-HQAKAYADTYGQIKRLGLEVEEY--TAGLESLK---- 132  Bacillus halodurans
15895531   75 FDEVGGIAREHMNSSGKSMLFYHIMNTL-KSEFRVFALSARQKGFVNTIADTVSEFKKYELTTEVLRDTIDEIEDEel-- 151  Clostridium aceto...
15671985   74 DKREKATTKTELGTAGLSMLFRRVLRSFsKEEIPLYFSLQDSAGFLEMLIQLRTELLTANLSVENLPDSPKNQELK---- 149  Lactococcus lacti...
15926555   76 FQEVGSYSEQKLSKAATEMMIYNIVQEQ-QKYLKLYQSQAKYYGFSEKLTEQIQDFKKYAVTPEHLEHFIADKNMQtrt- 153  Staphylococcus au...
15901016   71 VLND-LPAKTTLDDIGLGLAFYKCLAELdPKDLRVYGAIKQDPQLIQQLIELYHEMTKSQMSFLDLENLTDEDKRA---- 145  Streptococcus pne...
15674821   71 TVES-SPSKQHLDDTTLAMIFYRALMQLkPEDLPSYGRLQNNSVFIEQLVELYKELKNAQLSVHDLTGLDHPQKQE---- 145  Streptococcus pyo...
16801432   74 LQETGGLSKTFLSQTGIEMVIRKAALDQ-KDKLKIFSRATSKKGFYSELAKLFKEMKQEEISVDELEKSAANLSTSvs-- 150  Listeria innocua
113346    155 ervlseKLHDLSILYQQMEKSLADQYLHSEDYLTLLAEH---IPLAEDIKGAHIYVDGFYQFTPQEFRVLEQLMVHAEHI 231  Bacillus subtilis
15615543  133 ---------PLFKRYEQATVNE-NRLLDPEQKILVAANR---LSKRPSLMTGAVVVDGFYDFSPLQYRLITALKKADAPF 199  Bacillus halodurans
15895531  152 ----knKLHDLSLIYDEFNRLLYKNYIDPDDDLTILKDK---IKQSTVLQGAEIWLDEFSSFIPQQYGIIEELLKKCSRV 224  Clostridium aceto...
15671985  150 ---------KILSRFEEKLANDYANYSEFGDFTSRLAD----GEFDFQLKDVTIVIDGYTRFSAEEELFIESIQDRVARF 216  Lactococcus lacti...
15926555  154 ----knKLEDIALIYREFEQRIQNEFITGEDSLQYFIDC---MPKSEWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSV 226  Staphylococcus au...
15901016  146 ---------DLLLIFEKVTAYLNQGQLAQESQLSHLIEAienDKVSSDFNQIALVIDGFTRFSAEEERVVDLLHGKGVEI 216  Streptococcus pne...
15674821  146 ------DLIKIIELAETIMIQQDYNQDSPLQSFARAIKL---GLLNNQLSKTVVVIDGFSRFSAEEDYLLSLLNNNCQEV 216  Streptococcus pyo...
16801432  151 -----sKVHDISLIYQKYEELLAGKFLENEDYLRLLADK---IIESDYLNQTEIIIDGFTSFSKQELTVIEKLMQKCDKV 222  Listeria innocua
113346    232 TFSLTADKPSYEREPHELELFRMTGKTYYRLHQKAKELNLDIT-YKELSGTe--RHTKTPELAHLEAQYEARPAIPYAEK 308  Bacillus subtilis
15615543  200 HVYLPQA------------TFAIAKQTLNDLLSLG----------------------FEQKTVHHRNDLMTE-------- 237  Bacillus halodurans
15895531  225 NITLTMD---YDNASKDNDIFSVTQNTEKRLLKLAENNNISIEkPINLNGRpfyRFKNSPELSFLEKNLYSFPYEIYKKG 301  Clostridium aceto...
15671985  217 VIGTYSDENSLTAGSETIYISTSQMIGRFRSKFPVELRKMAFS-SVNEVYN---KLTKLLDLDSRFAISDQN-IEINSAD 291  Lactococcus lacti...
15926555  227 TIILTTDG-----NHDQFSLFRKPSEVLRHIEEIANELNISIErQYFNQLY----RFNNQDLKHLEQEFDVLQINRVACQ 297  Staphylococcus au...
15901016  217 VIGAYASKKAYTSPFSEGNLYQASVKFLHHLASKYQTPAQDCS-QTHEKMD---SFDKASRLLESSYDFSELALDVDEKD 292  Streptococcus pne...
15674821  217 IIGSYVSQKAYQKSFIKGNIYEASLHFLQDLAQKYHIKPVFAT--SNQVFKp--AFSRLTQLFEATHDFSQVDWQLQKSD 292  Streptococcus pyo...
16801432  223 TVSLTLNVPEIHKGLEDFSMFKASTEAYFALLEMAKLNKIQVE-PEKILLEn--KRANSDSLAFLANAWGDNKYSSYEGG 299  Listeria innocua
113346    309 QEALTVMQAANRRAELEGIAREIHALVREk-GYRYKDVAILARQPEDYKDMVKEVFADYEIPYFIDGKASMLNHPLIEFI 387  Bacillus subtilis
15615543  238 --SISVKAASTTEEQYYGLMQDIILSEKP-----YDAFGIVLADEKADEAVLFRVAKFLGVPLQRSKRRSARDSAILHWL 310  Bacillus halodurans
15895531  302 PDKIEIFKTSNLYTEVEKIARNIIEFVREd-NVRFSDIAVVTGDLGSYEKTVSVIFKEYRIPFFIDRNKDIEDNTLIILI 380  Clostridium aceto...
15671985  292 AKYFRIWEAENQKVEIEGVAKEIRQKISQ--GAFFKDFTVLVGDPAAYEITLKEIFELYEIPFFYAQEESMSQHPLVIFF 369  Lactococcus lacti...
15926555  298 G-HINILESATMREEINEIARRIIVDIRDk-QLRYQDIAILYRD-ESYAYLFDSILPLYNIPYNIDTKRSMTHHPVMEMI 374  Staphylococcus au...
15901016  293 RENLQIWSCLTQKEELELVARSIRQKLHEnsDLSYKHFRILLGDVASYQLSLKTIFDQYQIPFYLGRSEAMAHHPLTQFV 372  Streptococcus pne...
15674821  293 LDHFSLWQCHHQKEEIEHVAKSIRQKLYE--GYRYKDILVLLGDMDAYQLQIGPIFDKFEIPYYLGKAEPMAAHPLVQFI 370  Streptococcus pyo...
16801432  300 ANDLTIHQANNRRAEMEGVAREIRQLALN--GYRYRDIAILTRNIGDYDILCETVMESFDIPIFIDKKRAMAKHPFIEFI 377  Listeria innocua
113346    388 RSSLDV---LKGNWRYEAVFRCVKTELLFPLNEPkakvrEQVDQLENYCIAYGIKGD-RWTKgdRFQYRRFVSldddfa- 462  Bacillus subtilis
15615543  311 DYVLRMpsrAATSWEQLPLLELIMKLT-FKSGAS-------FALAKKSFLATGDVADeGIER---L-IELVRG------- 371  Bacillus halodurans
15895531  381 KSIIDI---FVKNWSYETVFRYLKTG--FADIEP-----DEIDILENYVLAAGIKGKkKWTEe-EWTYNVYGDalegd-- 447  Clostridium aceto...
15671985  370 ESLLSI---KKNNYGTDDVVNLLKSKVYTDVNLDe----EVIDYFEYYVQKYKISGRkKFTE--AFNESEFSK------- 433  Lactococcus lacti...
15926555  375 RSLIEV---IQSNWQVNPMLRLLKTDVLTASYLKs---aYLVDLLENFVLERGIYGK-RWLDdeLFNVEHFSKmgrkahk 447  Staphylococcus au...
15901016  373 ESILAL---KRYRFRQEDLINLLRTDLYTDLSQS------DIDAFEQYIRYLGINGLpAFQQ--TFTKSHHGK------- 434  Streptococcus pne...
15674821  371 ESLERS---QRYNWRREDILNMLKSG-LFGCFDD-----SDIDRFEEYTQFADIKGFtKFSK--PFTINSSRQ------- 432  Streptococcus pyo...
16801432  378 RSSIDA---ILFNWKYEPIFQAVKTEFFFDVAENatimrRKADILENYVLENGIQNKwKWEKegdWIYRKIRGlstnvlp 454  Listeria innocua
113346    463 qtdqeIEMENMLNDTRDWIVPPLFQLQKrMKKAKTVQEKAEALYRYLEETDVPLKLDQERQRAEDDGRIIEAQQHQQAWD 542  Bacillus subtilis
15615543  372 -------NVWRKRDTFLAYLHQLERLLD---DSELSSLYEQRMRESHETWRAQEIAFE-------L--HVMTYLKSLVQE 432  Bacillus halodurans
15895531  448 iseesKEKLSKVNEIKNRFLRPILNFRErVLRRNNVAEICRALFEFLYDINVPEAVEKMVNEFRESGRQILANEYSQIWN 527  Clostridium aceto...
15671985  434 -----IELVNQLRENLLGNDSPLQVFLG-TNRQKTGKKWVSDLQVLLENGNVMANMNTYFSEAESENKHQMADKHEQVWQ 507  Lactococcus lacti...
15926555  448 ltedeRNTFEQVVKLKKDVIDKILHFEKqMSQAETVKDFATAFYESMEYFELPNQLMTERDELDLNGNHEKAEEIDQIWN 527  Staphylococcus au...
15901016  435 ------FNLERLNVLRLRILAPLETLFA--SRKQKAEKLLQKWSVFLKEGAVTKQLQD----LTTTLEAVEQERQAEVWK 502  Streptococcus pne...
15674821  433 ------YPLDFLNEMRQDIVLPLQELFK--SQKQLGASLVDKLILFLKKIRLAENMQG------LAQSQLEVEKNEEVWK 498  Streptococcus pyo...
16801432  455 qtdeeLATQSVINEMRNLIVEPLSTLENnITKAKTGIEFAMALYHYLEQVKAVEHLESWRQVAEENGYLELAREHEQAWS 534  Listeria innocua
113346    543 AVIQLLEEFVEMMGDDEISLDLFQQMIEAGAESLTFSLIPPALDQVFVGNMDLSRMYGTSCTFVLGANDGVLPARPDENG 622  Bacillus subtilis
15615543  433 KRQELEEKGLMAFT---IRLDLFREWLHYQLERKKFTIEKGRERGVSIHTWRDVPLFQGDKLYVTSMNEGTFPAPHSLQG 509  Bacillus halodurans
15895531  528 IIIELMDQLVEVMGNEKVNLEQFSRILFIGIKEHKMGLIPSSLDQVLVGSIDRLKSHAIKILYIIGVNDGVFPSAAMEEG 607  Clostridium aceto...
15671985  508 MLISILNEFLAVFSDEKLKSVEFLDILLAGLKNAKYRQIPANVDVVNIKDYELVEPKTNKYIYAIGLSQTNFPRIKKNST 587  Lactococcus lacti...
15926555  528 GLIQILDDLVLVFGDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAKVDNKQHVYLVGMNDGTMPQPVTASS 607  Staphylococcus au...
15901016  503 AFCHVLEQFATVFAGSQVSLEDFLALLHSGMSLSQYRTIPATVDTVLVQSYDLIAPLTADFVYAIGLTQDNLPKISQNTS 582  Streptococcus pne...
15674821  499 RFTDILTSFHHIFGQEKLRLSDCLALIKTGMKSAQYRVVPATLDVVTIKSYDLVQPHSKPFVYAIGLTQSHFPKQIHHSG 578  Streptococcus pyo...
16801432  535 SISELLDEFVEVLGEEELDVNSFSEIITTGLDALEFSLLPPSLDQVVLADMENAKLLNMKVIFAIGMNDGVMPLRQKDKG 614  Listeria innocua
113346    623 VLSDDDREWLKTIG---VELSSGGRERLLDEHFLIYMAFSSPSDRLYVSYPIADAEGktllPSMIVKRLEELFPHHKeRL 699  Bacillus subtilis
15615543  510 YVQERD---LYSLP---IPYGAPTQHVFKMKQEAYFDQLFYIAPEIVFSY----IKG--------MNPNEPFLP-----S 566  Bacillus halodurans
15895531  608 ILSDRDREILNSKG---VELAKDTKTQAMEQRFLVYTAITNSKEYLFLSYPIADYEGktlrPSLIVNRVKTLFPKIVeKS 684  Clostridium aceto...
15671985  588 LLSDEERLEINQTTdenQFIEQLNVVNYQKNQFTVLSLVNSAKETLVLSMPQIMAN-----EQGEFSPVFQLFLNHSdEK 662  Lactococcus lacti...
15926555  608 LITDEEKKYFEQQAn--VELSPTSDILQMDEAFVCYVAMTRAKGDVTFSYSLMGSSGddkeISPFLNQIQSLFN----QL 681  Staphylococcus au...
15901016  583 LLTDEERQNLNQATeegVQLLIASSENLKKNRYTMLSLVNSARKQLFLSAPSLFNES-----ESKESAYLQELIHFG--F 655  Streptococcus pne...
15674821  579 LLSDQERARINEIRn-yRHFDIASAENSKKNHQTALSLFNAATKELVLSVSTVINET-----FDDLSPYLKELINFG--L 650  Streptococcus pyo...
16801432  615 ILSDQDRDSLRVEN---SNLKPSAKNNIGEEDLLAYKIMSLPSDKLFLSYPAADEEGkvlsESNYLRKIKGQFKNLNeSV 691  Listeria innocua
113346    700 LTNEPEQVSDEEQLMYVVNKSVAQSFTASQLRLWTREY----DISDVWWSTYNVLMSE-QdRLQSKKLFSSLFFRNEVKQ 774  Bacillus subtilis
15615543  567 PFLDRYVATETYEWTFEKRMEAPFALTVGE-QQEKAAH------FLGKGYVINGLSPE-----IER-----IHQHVERLK 629  Bacillus halodurans
15895531  685 DVIKIE--NDEESMKLISATVPTFNEMISSFRKEIDGEg---EVSSIWHDVYRWYSKSdEwTGKCNNMFKAISYTNQVDY 759  Clostridium aceto...
15671985  663 ILQKIQEVNLFESLEHIGNSRSVISMIGKIERELVETEekndDKRVFWSSIFRILVKS---NPDFQKILLDLAKDIDTVN 739  Lactococcus lacti...
15926555  682 EITNIPQYHEVNPLSLMQHAKQTKITLFEALRAWLDDE----IVADSWLDAYQVIRDSdHlNQGLDYLMSALTFDNETVK 757  Staphylococcus au...
15901016  656 RRREKRMNHKGLSKEDMGSYHSLLSSLVAYHQQGEMSDt--eQDLTFVKVLSRVIGKKlD-QQGLENPAIPTSPSSKTLA 732  Streptococcus pne...
15674821  651 PLLDKGKNYLSYDNSDIGNYKALLSQIIAINRQDLIEMs--dQDKMFWTVVLRYLRKQlR-KQQLELPTSDYRLSTKPLS 727  Streptococcus pyo...
16801432  692 YLTDPSLLNDKEQSSYIRSKQATLGLLTSQLQMYKRGY----PLSNVWWDAYNSYFEDsKeSEAAKQVLSSLYYENKTKP 767  Listeria innocua
113346    775 LERSVSRQLYGERIQGSVSRMETFNACPFSHFASHGLHLKE--RQFFKLEAPDIGQLFHSSLKLISDRLRDEKLDWRDLT 852  Bacillus subtilis
15615543  630 TGEEALSEPLSAQHTLSVTALEQYARCPFRFGMERIFAVKEpmKKDVRVSPLDLGHLIHQVIQHIYEEEDLIGQPFHRLS 709  Bacillus halodurans
15895531  760 ISEEKALKLYGGSLKMSVSRLEKYIECPFSYYVQYGLNIKD--RKIFSLTPPDLGSFMHKVIDRFCETIKEENIDWNEVN 837  Clostridium aceto...
15671985  740 LSQETLDQIYGDKLYASVSSFERFYNCEYQYFLETTLGLET--FENIDINSKIVGNFFHEVFEKVMQEEALS--AENFD- 814  Lactococcus lacti...
15926555  758 LGETLSKDLYGKEINASVSRFEGYQQCPFKHYASHGLKLNE--RTKYELQNFDLGDIFHSVLKYISERING---DFKQLD 832  Staphylococcus au...
15901016  733 KDTLQALYPAKQEFYLSTSGLTEFYRNEYSYFLRYVLGLQE--ELRLHPDARSHGNFLHRIFERALQLPNE----DSFD- 805  Streptococcus pne...
15674821  728 KEVIEVCFPKGIPLKLSATALTVFYNNQYNYFLKYVLNLNK--TESIHPDSRIHGQYLHRVFERLMKDHTQ----EPFDN 801  Streptococcus pyo...
16801432  768 LQETTAKNLFGENIHASVSRMEKFFSCEFQHFAQYGLKLEE--RAHYKLQAVDMGEIFHGAMEWISAELKRTNRDWGNLT 845  Listeria innocua
113346    853 KEQCELFSYDAVERLAP--KLQKEILLSSNRHYYVKEKLQKIVTRVSGILSEHAKASGFVPIGLELGFGGKGp----LPP 926  Bacillus subtilis
15615543  710 ETDKGRIGQKVESVFLTlwEEVEQRYLSLSRLELELIKREWLKRLRKWWEAERKHFWDHEPVKEMAIYSLER-----SVS 784  Bacillus halodurans
15895531  838 DHICEEKIYKIVDQEIE--GRGGSILNSSPRYSYIALRLKRILKRTVRIVAEQFKRGSFKPVGYEVSFENGGs----YPP 911  Clostridium aceto...
15671985  815 ----EKLTKVLHDVDSN--YSRYFTHDATARFTWTN--LEEIVRQTATVLKETVSTDELKTLLTESSFGLPK-------S 879  Lactococcus lacti...
15926555  833 LKKIRQLTNEALEEILP--KVQFNLLNSSAYYRYLSRRIGAIVETTLSALKYQGTYSKFMPKHFETSFRRKPrtndeLIA 910  Staphylococcus au...
15901016  806 ----QRLEQAIQETSQE--REFEAIYQESLEAQFTKEVLLDVARTTGHILRHNPA---IETIKEEANFGGKD-------Q 869  Streptococcus pne...
15674821  802 -----KLKQAIYHTNQE--SFFQQVYQDNAEAEYSLAILEDIVRSTAPILQLNQN---IQVIDQEKNFQLDM-------- 863  Streptococcus pyo...
16801432  846 EEECRQMAKLAMTFLAP--KIQHEILLSSKRMEYIQYKLLQIITRATTVLNEQAKSSAFRPIGLEVDFGLKGd----IPP 919  Listeria innocua
113346    927 LTFQLKNGCTMELVGRIDRVDKAESSKglLLRIVDYKS--SDKGLDLAEVYYGLALQMLTYLDLSITHSADWl-gMrATP 1003 Bacillus subtilis
15615543  785 LPIRLPSGTTITLTGKVDRIDVDHEG----FTIYDYKTg-QAHLKMEEDVPSGLKLQLPLYMIAAGQQLKEK------KA 853  Bacillus halodurans
15895531  912 ITVGLNDGSEVVLTGRIDRIDMMEKDGstYIRIVDYKS--GNKIFKLSDVYYGFDIQLLLYLNAILENENLDe-eDkVLP 988  Clostridium aceto...
15671985  880 E-LGNFSVDDIYLRGRIDRLDQLSSD---YLGAIDYKS--SAHSFKLQDAYDGLSLQFMTYLDVIKEAFPNQ---K---I 947  Lactococcus lacti...
15926555  911 QTLTTTQGIPINIRGQIDRIDTYTKNDtsFVNIIDYKSseGSATLDLTKVYYGMQMQMMTYMDIVLQNKQRLgltDiVKP 990  Staphylococcus au...
15901016  870 AFIQLDNGRSVFVRGKVDRIDRLKANG--AIGVVDYKS--SLTQFQFPHFFNGLNSQLPTYLAALKREGEQN-------F 938  Streptococcus pne...
15674821  864 -----GN--EILVHGIIDRIDQLSDG---SLGIVDYKS--SANQFDIGTFYNGLSPQLMTYLAALKQIAPHD---I-NQL 927  Streptococcus pyo...
16801432  920 LKIPLQSDSELLLQGRIDRIDAAEQDDrtFLRIIDYKS--SSHDLALTEVYYGLALQMLTYLDIVVTNAQKMi-gKtAEP 996  Listeria innocua
113346   1004 AGVLYFHIHDPMIQSN--LPLGLDEIEQEIFKKFKMKGLLLGDQEvvrLMDTTLQeg-rsNIINAGLKKDGSLRsd-saA 1079 Bacillus subtilis
15615543  854 YGASYISLKEPEKRAN----NGLWKPEHVGKGSRFRVSAFCKNR-----HEQ--------------------LG------ 898  Bacillus halodurans
15895531  989 GAILYFTMDDPIIKGK--NNLTDEQIREEIMKSLKMKGLLLSDPDvikEMDREMEgs--sIIIPASIKKDGTLGrs--sA 1062 Clostridium aceto...
15671985  948 WGALYLQFKNQPINLS--EINHLSEIAGLLKESMRYDGLVLEEA-----ADQIKA-----IENITVKKSN-IYN-----Q 1009 Lactococcus lacti...
15926555  991 GGLLYFHVHEPRIKFKswSDIDEDKLEQDLIKKFKLSGLVNADQTvidALDIRLEpkftsDIVPVGLNKDGSLSkrgsqV 1070 Staphylococcus au...
15901016  939 FGAMYLEMAEPVQSLM--AVKSLAGAVVEASKSMKYQGLFLEKE------SS---------YLGEFYNKN-KAN-----Q 995  Streptococcus pne...
15674821  928 FGAMYLHLQDPKLDLVt-FKQIDNTLVESIYKALTYKGIFSEVEK---EHLS----------TGAYQTKNALYS------ 987  Streptococcus pyo...
16801432  997 AGVLYFHMHNQYVQAE--KELSDEAIARELQKSSKMKGLILSDPVavsLMDTNLEkgkssNIIPAEIKQNGELSar-srT 1073 Listeria innocua
113346   1080 VGEKEFDLLTKHVRRTFQEAGEQITDGRVSIEPYKMKNK--------TPCTYCAFKSVCQFDESLEENEY----RPLKAE 1147 Bacillus subtilis
15615543  899 ----TIDFLHAFNLDERIEQLWQGMHEDFSVMPLDCSKS-------------CPYHAVCRVTPEQ---------REEGET 952  Bacillus halodurans
15895531 1063 ATKEQFDILIEHVRNLVVKNCENLLMGDIRIKPYKKGKE--------KPCDYCMYSSICRFDTMFDGNNY----RYVKEK 1130 Clostridium aceto...
15671985 1010 E---EFEQLLKLNENHYQHAGQRLKSGQIAINPIMKRSEgidqtgnvRGCRYCPLKSICRFEANVHMNDHs---REIGQK 1083 Lactococcus lacti...
15926555 1071 ADEATIYKFIQHNKENFIETASNIMDGHTEVAPLKYKQK--------LPCAFCSYQSVCHVDGMIDSKRY----RTVDET 1138 Staphylococcus au...
15901016  996 LTDEEFQLLLDYNAYLYKKAAEKILAGRFAINPYTENGRs-------IAPYVQQHQAITGFEANYHLGQArfleKLDLAD 1068 Streptococcus pne...
15674821  988 -N-DELETLLNYNKYLYLKAAKHIKKGHFLINPYTSDGK---------TVQGDQLKAITRFEADLDMGQAr---RLVTLP 1053 Streptococcus pyo...
16801432 1074 ATKAEFDKMRRFVRQKYQEAGNKILDGAVSINPYKLKEK--------TPCQFCGFRSFCGFDPSLASNQY----RHLTNE 1141 Listeria innocua
113346   1148 KDKTILEWIKKEAd--GNE 1164 Bacillus subtilis
15615543  953 SWQ---------------- 955  Bacillus halodurans
15895531 1131 SDEEVWKLIEREMseeGDE 1149 Clostridium acetobutylicum
15671985 1084 SQAEILAELKGEG---RNE 1099 Lactococcus lactis subsp. lactis
15926555 1139 INPIEAIQNININdefGGE 1157 Staphylococcus aureus subsp. aureus N315
15901016 1069 GKRLVGEKLKQAWlekIRE 1087 Streptococcus pneumoniae TIGR4
15674821 1054 AKEKKECFLTLMR---KES 1069 Streptococcus pyogenes M1 GAS
16801432 1142 KTETILTKMDIEG---GTQ 1157 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap