Conserved Protein Domain Family
SpoIIIAA

?
COG3854: SpoIIIAA 
Stage III sporulation protein SpoIIIAA [Cell cycle control, cell division, chromosome partitioning]
Statistics
?
PSSM-Id: 226372
View PSSM: COG3854
Aligned: 5 rows
Threshold Bit Score: 404.986
Threshold Setting Gi: 17229801
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329574  14 DDLEQLLSILPKPIQAIIAEHPQ--RQQLVEVVMDLGRLPEARFPGTAVYLGHEP----IAKEDLQYAIDRVG---LFS- 83
gi 15615360   1 --MQEIFAVLPETIRQLLKKLPPsiQKDVEEIRIRVHRPLEVIVNHLPHYPEHQGceyvVTTKDAQFLLNQLSaysIYAf 78
gi 730774     1 --MNEIAEVLPESMKNALSEIPEqqWLEIEEVRIRINRPVELIRRGQPVYLSYAG-----TAEDAHLILSRLSnysMYTl 73
gi 15895363   1 MNLEDIFSILPEKIEREVKRISD--YNNLQEIRIKVNKPLIIQIGKKEIISNYIA-----TKEDLKKTFNVMSgysIYSv 73
gi 17229801   5 DDLQKLLDILPQDLRQILENHPK--RDSLVEVVLDLGRRPEARFPNQAEYLSETP----VTQAQIDDCVQRVG---NFG- 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329574  84 -SDNRAG--IERTLHRISAIRNRTNE---------IIGLTCRVGRAVFGTIN--LIQDLVETGES-LLLLGRPGVGKTTA 148
gi 15615360  79 eEELKRGfiTMAGGHRVGLAGKVTLEkgyvktvrdISSFNIRVAKQKIGTAEp-LISHVYQKGWLnTLLIGPPQSGKTTL 157
gi 730774    74 eEELKKGyvTIRGGHRVGLAGRVITEnggvkglrdIASFNIRIARQKLGIAEp-LLPYLYQNSWLnTLIIGPPQTGKTTL 152
gi 15895363  74 eDELRQGyiTIKGGHRVGICGDCVLEenkiktiknISSLNIRICKEVTGCSNsiMKKIVYGNTVLnTIIISPPNCGKTTL 153
gi 17229801  75 -GDNRAG--IEQTLHRISGIRNRSGK---------IIGLTCRVGRAVFGTIG--MIRDLVETGKS-ILMLGRPGVGKTTA 139
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16329574 149 LREIARVLADD------LHKRVVIIDTSNEIAGdGDIPHPAIGRARRMQVARPELQHQVMIEAVENHMPEVIVIDEIGTE 222
gi 15615360 158 LRDLARLVSVGwsrkgiPPLKVGIVDERSEIAA-AVKGVPQHELGMRVDVLDGCPKAEGMMMMIRSMSPDVLIVDEIGRK 236
gi 730774   153 LRDLARLSSTGkk--nmLPVKTGIVDERSEIAG-CLRGIPQHQFGQRIDVLDACPKAEGLMMMIRSMSPEVMIVDEIGRM 229
gi 15895363 154 LRDITRNISYGinsiqfRGKKVCVIDERSEIGA-CLNGVNQMDIGIRTDILDNCPKSIGIMMAIRSMAPEVIICDEIGTY 232
gi 17229801 140 LREIARVLADE------LHKRVVIIDTSNEIAGdGDVAHPAIGRARRMQVAHPELQHQVMIEAVENHMPEVIVIDEIGTE 213
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 16329574 223 LEALAARTIAERGVQLVGTAHGNRLENLIKNPTLSDLVgGIQAVTLGDEEARRRGSQKTVLERKAPPTFSMAVEMLERQ 301
gi 15615360 237 EDCVAIQEALHAGVKVMTTAHGYELEEVSKRPAIRELL-EIEAFDRCIELERRAKPGVVRRIR----NAKAKDVGYVS- 309
gi 730774   230 EDTDALLEALHAGVSVIVSAHGWSISDLMKRPSLKRLW-EERAFDRYLELSRAKGPGTVSQIYDKDGNVLSRTTGVKTC 307
gi 15895363 233 DDIKSILTAVNCGVKLITTIHGFGIEDLNSRDVFKDAI-KNNVFERAIVLSGRSGVGTVEYIYD--FYTKERERGL--- 305
gi 17229801 214 LEALAARTIAERGVQLVGTAHGNQIENLIKNPTLSDLVgGIQAVTLGDDEARRRGSQKTVLERKAPPTFEIAVEMLERQ 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap