Conserved Protein Domain Family
MalG

?
COG3833: MalG 
ABC-type maltose transport system, permease component [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 226354
View PSSM: COG3833
Aligned: 25 rows
Threshold Bit Score: 245.621
Threshold Setting Gi: 14520397
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15805590  92 QLRTGKNis-------------------yLAVLGDQLTHLFLILVVLVAVYPLFYVLLAAFD-PNNSLFAfpnftnpnif 151 Deinococcus radiodu...
15673667   1 -MKSYKT----------------------QRKLSLTFRYLLLVILALLWIFPVIWMILTSFAkNNNTGFV---------- 47  Lactococcus lactis ...
15829111   7 LIKTQKLnlnkltkvktkihlsdakqltfSEIIYLFFNYILLIFWALIIIFPVITMIVASFN-VFNPRYV---------- 75  Mycoplasma pulmonis
14520397   1 -------------------------mikrRDFLRTILMTGLALFVMFIILFPVYYIFTVSIKpVSTLATTe--------- 46  Pyrococcus abyssi
18314081   1 -------------------------------MRASLLQTTTAVIATALLFYPVFQIILLSLNkLPYFRIG---------- 39  Pyrobaculum aerophilum
18274495   1 MNNSIKL----------------------KRRLTQSLTYLYLIGLSIVIIYPLLITIMSAFK-AGNVSAF---------- 47  Streptococcus pneum...
15675249   1 ----MKN----------------------KRRFQLGLVYATLIILSIIWLFPIAWVILTSFR-SEGTAYV---------- 43  Streptococcus pyoge...
15675252   6 VSISMKR----------------------KRFFTQLLTYLYLISLVIVILFPILVTVSSAFR-PGNTTAF---------- 52  Streptococcus pyoge...
15898022   4 MMQIKKYr--------------------lFKILRLAISYLVLIIMAAFSIFPLYYVFMTSFSnAPNLISLa--------- 54  Sulfolobus solfatar...
16801293   4 FMKDQRT----------------------TKFLTQFFTYLFLTVLTIIILYPILITASSAFK-PGNIAAF---------- 50  Listeria innocua
15805590 152 yrSGLLPQLEKLttENFAKLFEAvtipgyqialavlggaglaalllmvlaqrlgnts----------------------- 208 Deinococcus radiodu...
15673667  48 --QSLFPQNWTL--ENYIGIFNN--------------------------------------------------------- 66  Lactococcus lactis ...
15829111  76 --S-LSPKTFTFgwDNFSYLFTS--------------------------------------------------------- 95  Mycoplasma pulmonis
14520397  47 --IELIPKNVTL--DAYKDVLFGfqgsklvgnfsgtisglgevkngrliirnaeiegvikkgpftilkfripvpivsgst 122 Pyrococcus abyssi
18314081  40 --GEFIPTLDSF-----MWVLQQ--------------------------------------------------------- 55  Pyrobaculum aerophilum
18274495  48 --KLDTNIDLNF--DNFKGLFTE--------------------------------------------------------- 66  Streptococcus pneum...
15675249  44 --NYFIPKTFTL--NHYINLFTN--------------------------------------------------------- 62  Streptococcus pyoge...
15675252  53 --SFHFDGPWTL--SNFKTLFQD--------------------------------------------------------- 71  Streptococcus pyoge...
15898022  55 -vSDLLPKHIYF--TAYKYLFTTn-------------------------------------------------------- 75  Sulfolobus solfatar...
16801293  51 --TLEWSDSWTL--NNFTRLFNE--------------------------------------------------------- 69  Listeria innocua
15805590 209 -------------------------------------egmakartwvtrivlaagvlllilvtpaqfqgatNESKFLLSV 251 Deinococcus radiodu...
15673667  67 -----------------------------------------------------------------------SQYPYAHWL 75  Lactococcus lactis ...
15829111  96 -----------------------------------------------------------------------ERSLYVNWY 104 Mycoplasma pulmonis
14520397 123 qsnenlkgefrgriegvltitkinrdssigfgiikdakvsgsingneisgvlrpiivrnkgeakltnlgkfVNSVFFHHL 202 Pyrococcus abyssi
18314081  56 -------------------------------------------------------------------------PEFWRGL 62  Pyrobaculum aerophilum
18274495  67 -------------------------------------------------------------------------TLYGTWY 73  Streptococcus pneum...
15675249  63 -----------------------------------------------------------------------ETFPFGKWF 71  Streptococcus pyoge...
15675252  72 -------------------------------------------------------------------------TLYLRWY 78  Streptococcus pyoge...
15898022  76 ----------------------------------------------------------------------lYGGSFPLWI 85  Sulfolobus solfatar...
16801293  70 -------------------------------------------------------------------------TLYLDWY 76  Listeria innocua
15805590 252 RNTLFVSTVTGLLAILLSTTAGYAMARLRFPGRFQMLLFFIFIQMFP---VFLALVAIYTLLSALG--LVNTFTGLILAY 326 Deinococcus radiodu...
15673667  76 LNTFILAVICAVANTFITTIMSYALSRLRFKFRKPFLQFALIIGMFP---GIMGMIAMYSILKSIN--MLN-IWGMALVY 149 Lactococcus lactis ...
15829111 105 INTVVISLITMAITVVFVALNGYAYSRFRFTGSKHSLSVIMLLQMVP---ATASLISLYIIVTLGKeiKIDPRFILVLIY 181 Mycoplasma pulmonis
14520397 203 KNSLILALLTVTLTLLFVVPAAYAFSRLKFFGREHVLYFYLMFTQVAgglGIAGLIALYGIMVKLG--LFNKLPALALVY 280 Pyrococcus abyssi
18314081  63 LNSLIVSLATVAIVIALSLPGAYAFSRYRFKGRDSLLSFYVVFTQMAgglGIAGLIALFAIVSALG--LRNNLLALAVIY 140 Pyrobaculum aerophilum
18274495  74 LNTLIIALITMAVQTSIIVLAGYAYSRYNFLARKQSLVFFLIIQMVP---TMAALTAFFVMALMLN--ALNHNWFLIFLY 148 Streptococcus pneum...
15675249  72 MNTLIVATFTCIISTFITVAIAYSLSRIKFKFRNGFLKLALILNMFP---GFMSMIAIYYILKALG--LTQTLTALVLVY 146 Streptococcus pyoge...
15675252  79 WNTLIVAFFTMLIQVTVITLTGYAYSRYNFFGRKKSLIFFLVVQMVP---TMAALTAYFVMAWLFN--ALNQYWFLILIY 153 Streptococcus pyoge...
15898022  86 RNSLILAGSTAIISVLLALITGYALSRLNVPAKKILATFIYIVTFFP---YTASAVPLYLLFAKFH--LLN-YIGLILAY 159 Sulfolobus solfatar...
16801293  77 KNTLIIAVVTMIMQVTIVTLAGYTYSRYRFKGRKNSLVFFLIIQMVP---TMAALTAFYVLAMLLG--ALDQYWFLTLIY 151 Listeria innocua
15805590 327 SGGAIAFNTWIYKGYVESLPESLEEAAMVDGATRWQTFRRVVLPLSGSMLVFIFLNQFIGTYAEFILASVLLT--GVEQW 404 Deinococcus radiodu...
15673667 150 VGGSG-LGFYVFKGFLDTIPRSIDEAATIDGATRWQTFIHITLPLSRPMIVYTSLMAFIGPWLDFMFSSYILGggDPKIR 228 Lactococcus lactis ...
15829111 182 AGGAIAGNTFIFKGYLDSISKELDDSAKIDGCGNWKLFYKILLPISKPMLSIIALWTFLIPFGDVILPRFTIT--DLRQT 259 Mycoplasma pulmonis
14520397 281 AAGSVPFNTWLLKSYIDSINPDFDEAALIDGATYLQIIRYVLLPMALPGIATVAVMSFIGGWTEFILASLLLE---QANQ 357 Pyrococcus abyssi
18314081 141 AAGAIPYHTWLLKTYIDTIPKSAEEAALIDGAGINTLLIRVVLPLMAPALAVSAILTFIGAWGELILANLFLS---GENR 217 Pyrobaculum aerophilum
18274495 149 VGGGIPMNAWLMKGYFDTVPMSLDESAKLDGAGHFRRFWQIVLPLVRPMVAVQALWAFMGPFGDYILSSFLLR--EKEYF 226 Streptococcus pneum...
15675249 147 SSGAA-LGFYIAKGFFDTIPYSLDESAMIDGATRMDIFFKITLPLAKPIIVYTALLAFMGPWIDFIFAQVILGdaTSKY- 224 Streptococcus pyoge...
15675252 154 VGGGIPMNAWLMKGYFDTVPYDLDESAKLDGSGHFRTFYQIVLPLVRPMIAVQSLWAFMGPFGDFMLAKFLLR--AQENY 231 Streptococcus pyoge...
15898022 160 TPGTSIFAAFIAKLSIDSIPPSYEEIAMIDGLSRFGAFLRIVMRLALPVVALTALLGFSGTYLDFALAYSFLLp-NVKEW 238 Sulfolobus solfatar...
16801293 152 IGGGIPMNTWLMKGYFDTVPRDLDESAKLDGAGHFRIFAQIILPLVRPMIAVQALWAFMGPFGDFLLAKFLLR--TPENL 229 Listeria innocua
15805590 405 TVGVMLRSFTSG---QFSTKWGVFAAAATLGALPIVALFYSFQNYFVGGAT-AGGVKE 458 Deinococcus radiodurans
15673667 229 TVAYGLQNMMTNskgSSATNLYQFIAGSVLIAVPITILFIVMQKFYVNGIT-AGADKG 285 Lactococcus lactis subsp. lactis
15829111 260 TLAVGLDSFISTd--PKHINAGAYSAGALLAAIPPFILFMVSQKNIVGNLG-EGSVKG 314 Mycoplasma pulmonis
14520397 358 PLSVWIYTLMGGi--GRGIDWNYFAAATLLFALPVFVMFMLAQKYIRSGLT-LGGLKE 412 Pyrococcus abyssi
18314081 218 TLILWIYSLMSN---VYSVQWNRFAAAALLYAIPPVALYVVLQKFLRRGLAfVY---- 268 Pyrobaculum aerophilum
18274495 227 TVAVGLQTFVNN---AKNLKIAYFSAGAILIALPICILFFFLQKNFVSGLT-SGGDKG 280 Streptococcus pneumoniae
15675249 225 TVAIGLFSMLQPd--TINNWFMAFTAGSVLIAVPITLLFMFMQKYYVEGIT-GGSVK- 278 Streptococcus pyogenes M1 GAS
15675252 232 TVAVGLQSFITNd--ARNPKVTLFAAGAILIAVPISVLFFFLQKNFVSGLT-SGGTKG 286 Streptococcus pyogenes M1 GAS
15898022 239 TATIGLYYMAGLlnqASAPAYNIFAAGAVIMGIPLMALFIVSQRMMTRAYSnLAGVKQ 296 Sulfolobus solfataricus
16801293 230 TIAVGLQTFIAN---PQQQKVALFAAGAILAALPICLLFFFLQKNFVSGLT-AGGTKG 283 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap