Conserved Protein Domain Family
MalG

?
COG3833: MalG 
ABC-type maltose transport system, permease component [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 226354
View PSSM: COG3833
Aligned: 25 rows
Threshold Bit Score: 245.621
Threshold Setting Gi: 14520397
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15805590  92 QLRTGKNis-------------------yLAVLGDQLTHLFLILVVLVAVYPLFYVLLAAFD-PNNSLFAfpnftnpnif 151
gi 15673667   1 -MKSYKT----------------------QRKLSLTFRYLLLVILALLWIFPVIWMILTSFAkNNNTGFV---------- 47
gi 15829111   7 LIKTQKLnlnkltkvktkihlsdakqltfSEIIYLFFNYILLIFWALIIIFPVITMIVASFN-VFNPRYV---------- 75
gi 14520397   1 -------------------------mikrRDFLRTILMTGLALFVMFIILFPVYYIFTVSIKpVSTLATTe--------- 46
gi 18314081   1 -------------------------------MRASLLQTTTAVIATALLFYPVFQIILLSLNkLPYFRIG---------- 39
gi 18274495   1 MNNSIKL----------------------KRRLTQSLTYLYLIGLSIVIIYPLLITIMSAFK-AGNVSAF---------- 47
gi 15675249   1 ----MKN----------------------KRRFQLGLVYATLIILSIIWLFPIAWVILTSFR-SEGTAYV---------- 43
gi 15675252   6 VSISMKR----------------------KRFFTQLLTYLYLISLVIVILFPILVTVSSAFR-PGNTTAF---------- 52
gi 15898022   4 MMQIKKYr--------------------lFKILRLAISYLVLIIMAAFSIFPLYYVFMTSFSnAPNLISLa--------- 54
gi 16801293   4 FMKDQRT----------------------TKFLTQFFTYLFLTVLTIIILYPILITASSAFK-PGNIAAF---------- 50
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15805590 152 yrSGLLPQLEKLttENFAKLFEAvtipgyqialavlggaglaalllmvlaqrlgnts----------------------- 208
gi 15673667  48 --QSLFPQNWTL--ENYIGIFNN--------------------------------------------------------- 66
gi 15829111  76 --S-LSPKTFTFgwDNFSYLFTS--------------------------------------------------------- 95
gi 14520397  47 --IELIPKNVTL--DAYKDVLFGfqgsklvgnfsgtisglgevkngrliirnaeiegvikkgpftilkfripvpivsgst 122
gi 18314081  40 --GEFIPTLDSF-----MWVLQQ--------------------------------------------------------- 55
gi 18274495  48 --KLDTNIDLNF--DNFKGLFTE--------------------------------------------------------- 66
gi 15675249  44 --NYFIPKTFTL--NHYINLFTN--------------------------------------------------------- 62
gi 15675252  53 --SFHFDGPWTL--SNFKTLFQD--------------------------------------------------------- 71
gi 15898022  55 -vSDLLPKHIYF--TAYKYLFTTn-------------------------------------------------------- 75
gi 16801293  51 --TLEWSDSWTL--NNFTRLFNE--------------------------------------------------------- 69
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15805590 209 -------------------------------------egmakartwvtrivlaagvlllilvtpaqfqgatNESKFLLSV 251
gi 15673667  67 -----------------------------------------------------------------------SQYPYAHWL 75
gi 15829111  96 -----------------------------------------------------------------------ERSLYVNWY 104
gi 14520397 123 qsnenlkgefrgriegvltitkinrdssigfgiikdakvsgsingneisgvlrpiivrnkgeakltnlgkfVNSVFFHHL 202
gi 18314081  56 -------------------------------------------------------------------------PEFWRGL 62
gi 18274495  67 -------------------------------------------------------------------------TLYGTWY 73
gi 15675249  63 -----------------------------------------------------------------------ETFPFGKWF 71
gi 15675252  72 -------------------------------------------------------------------------TLYLRWY 78
gi 15898022  76 ----------------------------------------------------------------------lYGGSFPLWI 85
gi 16801293  70 -------------------------------------------------------------------------TLYLDWY 76
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15805590 252 RNTLFVSTVTGLLAILLSTTAGYAMARLRFPGRFQMLLFFIFIQMFP---VFLALVAIYTLLSALG--LVNTFTGLILAY 326
gi 15673667  76 LNTFILAVICAVANTFITTIMSYALSRLRFKFRKPFLQFALIIGMFP---GIMGMIAMYSILKSIN--MLN-IWGMALVY 149
gi 15829111 105 INTVVISLITMAITVVFVALNGYAYSRFRFTGSKHSLSVIMLLQMVP---ATASLISLYIIVTLGKeiKIDPRFILVLIY 181
gi 14520397 203 KNSLILALLTVTLTLLFVVPAAYAFSRLKFFGREHVLYFYLMFTQVAgglGIAGLIALYGIMVKLG--LFNKLPALALVY 280
gi 18314081  63 LNSLIVSLATVAIVIALSLPGAYAFSRYRFKGRDSLLSFYVVFTQMAgglGIAGLIALFAIVSALG--LRNNLLALAVIY 140
gi 18274495  74 LNTLIIALITMAVQTSIIVLAGYAYSRYNFLARKQSLVFFLIIQMVP---TMAALTAFFVMALMLN--ALNHNWFLIFLY 148
gi 15675249  72 MNTLIVATFTCIISTFITVAIAYSLSRIKFKFRNGFLKLALILNMFP---GFMSMIAIYYILKALG--LTQTLTALVLVY 146
gi 15675252  79 WNTLIVAFFTMLIQVTVITLTGYAYSRYNFFGRKKSLIFFLVVQMVP---TMAALTAYFVMAWLFN--ALNQYWFLILIY 153
gi 15898022  86 RNSLILAGSTAIISVLLALITGYALSRLNVPAKKILATFIYIVTFFP---YTASAVPLYLLFAKFH--LLN-YIGLILAY 159
gi 16801293  77 KNTLIIAVVTMIMQVTIVTLAGYTYSRYRFKGRKNSLVFFLIIQMVP---TMAALTAFYVLAMLLG--ALDQYWFLTLIY 151
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15805590 327 SGGAIAFNTWIYKGYVESLPESLEEAAMVDGATRWQTFRRVVLPLSGSMLVFIFLNQFIGTYAEFILASVLLT--GVEQW 404
gi 15673667 150 VGGSG-LGFYVFKGFLDTIPRSIDEAATIDGATRWQTFIHITLPLSRPMIVYTSLMAFIGPWLDFMFSSYILGggDPKIR 228
gi 15829111 182 AGGAIAGNTFIFKGYLDSISKELDDSAKIDGCGNWKLFYKILLPISKPMLSIIALWTFLIPFGDVILPRFTIT--DLRQT 259
gi 14520397 281 AAGSVPFNTWLLKSYIDSINPDFDEAALIDGATYLQIIRYVLLPMALPGIATVAVMSFIGGWTEFILASLLLE---QANQ 357
gi 18314081 141 AAGAIPYHTWLLKTYIDTIPKSAEEAALIDGAGINTLLIRVVLPLMAPALAVSAILTFIGAWGELILANLFLS---GENR 217
gi 18274495 149 VGGGIPMNAWLMKGYFDTVPMSLDESAKLDGAGHFRRFWQIVLPLVRPMVAVQALWAFMGPFGDYILSSFLLR--EKEYF 226
gi 15675249 147 SSGAA-LGFYIAKGFFDTIPYSLDESAMIDGATRMDIFFKITLPLAKPIIVYTALLAFMGPWIDFIFAQVILGdaTSKY- 224
gi 15675252 154 VGGGIPMNAWLMKGYFDTVPYDLDESAKLDGSGHFRTFYQIVLPLVRPMIAVQSLWAFMGPFGDFMLAKFLLR--AQENY 231
gi 15898022 160 TPGTSIFAAFIAKLSIDSIPPSYEEIAMIDGLSRFGAFLRIVMRLALPVVALTALLGFSGTYLDFALAYSFLLp-NVKEW 238
gi 16801293 152 IGGGIPMNTWLMKGYFDTVPRDLDESAKLDGAGHFRIFAQIILPLVRPMIAVQALWAFMGPFGDFLLAKFLLR--TPENL 229
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 15805590 405 TVGVMLRSFTSG---QFSTKWGVFAAAATLGALPIVALFYSFQNYFVGGAT-AGGVKE 458
gi 15673667 229 TVAYGLQNMMTNskgSSATNLYQFIAGSVLIAVPITILFIVMQKFYVNGIT-AGADKG 285
gi 15829111 260 TLAVGLDSFISTd--PKHINAGAYSAGALLAAIPPFILFMVSQKNIVGNLG-EGSVKG 314
gi 14520397 358 PLSVWIYTLMGGi--GRGIDWNYFAAATLLFALPVFVMFMLAQKYIRSGLT-LGGLKE 412
gi 18314081 218 TLILWIYSLMSN---VYSVQWNRFAAAALLYAIPPVALYVVLQKFLRRGLAfVY---- 268
gi 18274495 227 TVAVGLQTFVNN---AKNLKIAYFSAGAILIALPICILFFFLQKNFVSGLT-SGGDKG 280
gi 15675249 225 TVAIGLFSMLQPd--TINNWFMAFTAGSVLIAVPITLLFMFMQKYYVEGIT-GGSVK- 278
gi 15675252 232 TVAVGLQSFITNd--ARNPKVTLFAAGAILIAVPISVLFFFLQKNFVSGLT-SGGTKG 286
gi 15898022 239 TATIGLYYMAGLlnqASAPAYNIFAAGAVIMGIPLMALFIVSQRMMTRAYSnLAGVKQ 296
gi 16801293 230 TIAVGLQTFIAN---PQQQKVALFAAGAILAALPICLLFFFLQKNFVSGLT-AGGTKG 283
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap