Conserved Protein Domain Family
ManY

?
COG3715: ManY 
Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IIC [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 226238
View PSSM: COG3715
Aligned: 33 rows
Threshold Bit Score: 144.677
Threshold Setting Gi: 1172737
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15900007   1 MIQWWQILLLTLYSAYQICDE-LTIVSSAGSPVFAGFITGLIMGDVTTGLLIGGNLQLFVLGVGTFGG-ASRIDATSGAV 78
gi 15833266   2 EISLLQAFALGIIAFIAGLDM-FNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVWMGLAPLAG-AQPPNVIIGTI 79
gi 15900256   2 SINVFQAILIGLWTAFCFSGM-LLGIYTN-RCIVLSFGVGIILGDLPTALAMGAIGELAYMGFGVGAGgTVPPNPIGPGI 79
gi 15674703   2 DINLLQALLIGLWTAFCFSGM-LLGIYTN-RCIILSFGVGIILGDLPTALSMGAISELAYMGFGVGAGgTVPPNPIGPGI 79
gi 16763952   1 --MLLTATLLGLIAALGILDGrLLGVSMIDRPLVMCALTGLVCGNLHEGILIGATLELIFLGNVAIGA-AVPPDVVTGSV 77
gi 16767054   1 MDTLLFASLMGLYYWFARLRLgYTFSAMLLQPVVIAVFVGLLLGNMQTAMIIGAGMQLVYLGVTSTPGgNVPSDPALAAC 80
gi 16121143   1 --MLFEATLVGIWAFLCGIDK-YDVALNIHRPLITGPVVGLIMGNMEVGLIAGATLELAWLGLVPNAG-AQPPDVTMGTI 76
gi 15803672   2 EISLLQAFALGIIAFIAGLDM-FNGLTHMHRPVVLGPLVXLVLGDLHTGILTGGTLELVWMGLAPLAG-AQPPNVIIGTI 79
gi 15803679   1 ----------------------------------------------------------------------------MAGL 4
gi 1172737    2 EISLLQAFALGIIAFIAGLDM-FNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVWMGLAPLAG-AQPPNVIIGTI 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15900007  79 LATAFSVSQGID-APLAITTIAVPVAALLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAI-PWALSRALPVF 156
gi 15833266  80 VGTAFAITTGv--KPDVAVGVAVPFAVAVQMGITFLFSVMSGVMSRCDRMAENADTRGIERVNYLALL-ALGTFYFLCAF 156
gi 15900256  80 FGTLMAITSAGKvSPEAALALSTPIAVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIW-LFAFIGFTLGC 158
gi 15674703  80 FGTLMAITSAGKvTPEAALALSTPIAVAIQFLQTFAYTAFAGAPETAKKQLQKGNIRGFKFAANGTIW-AFAFIGLGLGL 158
gi 16763952  78 LATAFSIMSGRG--PEAALTIAIPISMLAQTLGVLVRVVNARFGHMADRYAAQGNTRMVAVMHLGGPTlLYFLSGFLPVF 155
gi 16767054  81 ISIPIAVKAGMD--PNLAIALAIPFGVIGVFLDQLRRTLNAAWVHMADKHAETANMAGIMRCAFLYPAlLGLVLRFPVVF 158
gi 16121143  77 AAVAFAVMTGq--SPEVAMGVGMPIAVLMQMIIIGFFAMTAFTMGRADKYAEQADTAGISRLLIGTLL-TRSMLYFVIAF 153
gi 15803672  80 VGTAFAITTGv--KPDVAVGVAVPFAVAVQMGITFLFSVMSGVMSRCDRMAENADTRGIERVNYLALL-ALGTFYFLCAF 156
gi 15803679   5 MTTVIAWSTGv--DAKTAIGLGLPFSLLMQYVILFFYSAFSLFMTKADKCAKEADTAAFSRLNWTTML-IVASAYAVIAF 81
gi 1172737   80 VGTAFAITTGv--KPDVAVGVAVPFAVAVQMGITFLFSVMSGVMSRCDLATNPRRI------------------------ 133
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15900007 157 FALAFGgafvQSVVDFV--EAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLTAMLTVLysyvtglgga 234
gi 15833266 157 LPIYFG----AEHAKTIidVLPQRLIDGLGVAGGIMPAIGFAVLLKIMMKNVYIPYFILGFVAAAWLKLP---------- 222
gi 15900256 159 LGALS-----MDTLLKLvdYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNIP---------- 223
gi 15674703 159 LGALS-----MDTLLHLvdYIPPVLLNGLTVAGKMLPAIGFAMILSVMAKKELIPFVLIGYVCAAYLQIP---------- 223
gi 16763952 156 FAILLG----SAAVTWFldAIPAFITNGLVVASKILPALGFALLISMMLSSKLMPYLGLGFLIAAYTKLD---------- 221
gi 16767054 159 AANYFG----QDVVESFlkLMPHWLTHSFEIMGGILPALGFAITIMVIGKKSLLPWFIGGFFAVLYLKVD---------- 224
gi 16121143 154 VTVYFG----EHAATWIdeNTPTALLEGLGIGAKMVPAIGFAMLLKIMWSKEVAGVFFIGFVMTTYLKLP---------- 219
gi 15803672 157 LPIYFG----AEHAKTIidVLPQRLIDGLGVAGGIMPAIGFAVLLKIMMKNVYIPYFILGFVAAAWLKLP---------- 222
gi 15803679  82 LCTYLA----QGAMQALvkAMPAWLTHGFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSn--------- 148
gi 1172737      --------------------------------------------------------------------------------
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15900007 235 vagivgtlpaevaekigfvnnfkglsMIGISIVGIFLAVLHFKNSQKVAVAAPST-PSESGE-IEDDEF 301
gi 15833266 223 --------------------------VLAIAAAALAMALIDLLRK------SPEPtQPAAQKeEFEDGI 259
gi 15900256 224 --------------------------TIGIAIVGTIFALIEFYNK------PKTAdH-VVEEeAHDDWI 259
gi 15674703 224 --------------------------TIGIAIIGIIFALNEFYNK------PKQVdATTVQGgQQDDWI 260
gi 16763952 222 --------------------------IIAIALFAVVLAFIISQFLNTSQQEG----------------- 247
gi 16767054 225 --------------------------IMAMAIFGTCVAFLIKGLAKNEGAA------------------ 249
gi 16121143 220 --------------------------IMAIAILGAAVAVLYYFFSGNNNGSNNNGnNTNKQPeDFEDGI 262
gi 15803672 223 --------------------------VLAIAAAALAMALIDLLRK------SPEPtQPAAQKeEFEDGI 259
gi 15803679 149 --------------------------LLPVAVLGAGFAVYEFFNAKSRQQAQPQPvASKNEEeDYSNGI 191
gi 1172737      ---------------------------------------------------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap