Conserved Protein Domain Family
ManY

?
COG3715: ManY 
Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IIC [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 226238
View PSSM: COG3715
Aligned: 33 rows
Threshold Bit Score: 144.677
Threshold Setting Gi: 1172737
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15900007   1 MIQWWQILLLTLYSAYQICDE-LTIVSSAGSPVFAGFITGLIMGDVTTGLLIGGNLQLFVLGVGTFGG-ASRIDATSGAV 78  Streptococcus pneum...
15833266   2 EISLLQAFALGIIAFIAGLDM-FNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVWMGLAPLAG-AQPPNVIIGTI 79  Escherichia coli O1...
15900256   2 SINVFQAILIGLWTAFCFSGM-LLGIYTN-RCIVLSFGVGIILGDLPTALAMGAIGELAYMGFGVGAGgTVPPNPIGPGI 79  Streptococcus pneum...
15674703   2 DINLLQALLIGLWTAFCFSGM-LLGIYTN-RCIILSFGVGIILGDLPTALSMGAISELAYMGFGVGAGgTVPPNPIGPGI 79  Streptococcus pyoge...
16763952   1 --MLLTATLLGLIAALGILDGrLLGVSMIDRPLVMCALTGLVCGNLHEGILIGATLELIFLGNVAIGA-AVPPDVVTGSV 77  Salmonella typhimur...
16767054   1 MDTLLFASLMGLYYWFARLRLgYTFSAMLLQPVVIAVFVGLLLGNMQTAMIIGAGMQLVYLGVTSTPGgNVPSDPALAAC 80  Salmonella typhimur...
16121143   1 --MLFEATLVGIWAFLCGIDK-YDVALNIHRPLITGPVVGLIMGNMEVGLIAGATLELAWLGLVPNAG-AQPPDVTMGTI 76  Yersinia pestis
15803672   2 EISLLQAFALGIIAFIAGLDM-FNGLTHMHRPVVLGPLVXLVLGDLHTGILTGGTLELVWMGLAPLAG-AQPPNVIIGTI 79  Escherichia coli O1...
15803679   1 ----------------------------------------------------------------------------MAGL 4   Escherichia coli O1...
1172737    2 EISLLQAFALGIIAFIAGLDM-FNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVWMGLAPLAG-AQPPNVIIGTI 79  Escherichia coli
15900007  79 LATAFSVSQGID-APLAITTIAVPVAALLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAI-PWALSRALPVF 156 Streptococcus pneum...
15833266  80 VGTAFAITTGv--KPDVAVGVAVPFAVAVQMGITFLFSVMSGVMSRCDRMAENADTRGIERVNYLALL-ALGTFYFLCAF 156 Escherichia coli O1...
15900256  80 FGTLMAITSAGKvSPEAALALSTPIAVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIW-LFAFIGFTLGC 158 Streptococcus pneum...
15674703  80 FGTLMAITSAGKvTPEAALALSTPIAVAIQFLQTFAYTAFAGAPETAKKQLQKGNIRGFKFAANGTIW-AFAFIGLGLGL 158 Streptococcus pyoge...
16763952  78 LATAFSIMSGRG--PEAALTIAIPISMLAQTLGVLVRVVNARFGHMADRYAAQGNTRMVAVMHLGGPTlLYFLSGFLPVF 155 Salmonella typhimur...
16767054  81 ISIPIAVKAGMD--PNLAIALAIPFGVIGVFLDQLRRTLNAAWVHMADKHAETANMAGIMRCAFLYPAlLGLVLRFPVVF 158 Salmonella typhimur...
16121143  77 AAVAFAVMTGq--SPEVAMGVGMPIAVLMQMIIIGFFAMTAFTMGRADKYAEQADTAGISRLLIGTLL-TRSMLYFVIAF 153 Yersinia pestis
15803672  80 VGTAFAITTGv--KPDVAVGVAVPFAVAVQMGITFLFSVMSGVMSRCDRMAENADTRGIERVNYLALL-ALGTFYFLCAF 156 Escherichia coli O1...
15803679   5 MTTVIAWSTGv--DAKTAIGLGLPFSLLMQYVILFFYSAFSLFMTKADKCAKEADTAAFSRLNWTTML-IVASAYAVIAF 81  Escherichia coli O1...
1172737   80 VGTAFAITTGv--KPDVAVGVAVPFAVAVQMGITFLFSVMSGVMSRCDLATNPRRI------------------------ 133 Escherichia coli
15900007 157 FALAFGgafvQSVVDFV--EAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLTAMLTVLysyvtglgga 234 Streptococcus pneum...
15833266 157 LPIYFG----AEHAKTIidVLPQRLIDGLGVAGGIMPAIGFAVLLKIMMKNVYIPYFILGFVAAAWLKLP---------- 222 Escherichia coli O1...
15900256 159 LGALS-----MDTLLKLvdYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNIP---------- 223 Streptococcus pneum...
15674703 159 LGALS-----MDTLLHLvdYIPPVLLNGLTVAGKMLPAIGFAMILSVMAKKELIPFVLIGYVCAAYLQIP---------- 223 Streptococcus pyoge...
16763952 156 FAILLG----SAAVTWFldAIPAFITNGLVVASKILPALGFALLISMMLSSKLMPYLGLGFLIAAYTKLD---------- 221 Salmonella typhimur...
16767054 159 AANYFG----QDVVESFlkLMPHWLTHSFEIMGGILPALGFAITIMVIGKKSLLPWFIGGFFAVLYLKVD---------- 224 Salmonella typhimur...
16121143 154 VTVYFG----EHAATWIdeNTPTALLEGLGIGAKMVPAIGFAMLLKIMWSKEVAGVFFIGFVMTTYLKLP---------- 219 Yersinia pestis
15803672 157 LPIYFG----AEHAKTIidVLPQRLIDGLGVAGGIMPAIGFAVLLKIMMKNVYIPYFILGFVAAAWLKLP---------- 222 Escherichia coli O1...
15803679  82 LCTYLA----QGAMQALvkAMPAWLTHGFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSn--------- 148 Escherichia coli O1...
1172737      -------------------------------------------------------------------------------- Escherichia coli
15900007 235 vagivgtlpaevaekigfvnnfkglsMIGISIVGIFLAVLHFKNSQKVAVAAPST-PSESGE-IEDDEF 301 Streptococcus pneumoniae TIGR4
15833266 223 --------------------------VLAIAAAALAMALIDLLRK------SPEPtQPAAQKeEFEDGI 259 Escherichia coli O157:H7
15900256 224 --------------------------TIGIAIVGTIFALIEFYNK------PKTAdH-VVEEeAHDDWI 259 Streptococcus pneumoniae TIGR4
15674703 224 --------------------------TIGIAIIGIIFALNEFYNK------PKQVdATTVQGgQQDDWI 260 Streptococcus pyogenes M1 GAS
16763952 222 --------------------------IIAIALFAVVLAFIISQFLNTSQQEG----------------- 247 Salmonella typhimurium LT2
16767054 225 --------------------------IMAMAIFGTCVAFLIKGLAKNEGAA------------------ 249 Salmonella typhimurium LT2
16121143 220 --------------------------IMAIAILGAAVAVLYYFFSGNNNGSNNNGnNTNKQPeDFEDGI 262 Yersinia pestis
15803672 223 --------------------------VLAIAAAALAMALIDLLRK------SPEPtQPAAQKeEFEDGI 259 Escherichia coli O157:H7 EDL933
15803679 149 --------------------------LLPVAVLGAGFAVYEFFNAKSRQQAQPQPvASKNEEeDYSNGI 191 Escherichia coli O157:H7 EDL933
1172737      --------------------------------------------------------------------- Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap