Conserved Protein Domain Family
IcmF

?
COG3523: IcmF 
Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport]
Statistics
?
PSSM-Id: 226054
View PSSM: COG3523
Aligned: 15 rows
Threshold Bit Score: 776.2
Threshold Setting Gi: 15597557
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984    1 MRRFLN---FLTHSRTLSVLGVLALTIILLLIALTFEIGLVWAG-------IALGVLLALWLATALWKRWRARRASAr-- 68
gi 15890651   10 IRSYVEsyaALVGRRFLSLLWVIALCVVVWFYGYLIALGDFKPLgtvqarlIAIGIIVAVWLVYIIVTIYRGRKQDK--- 86
gi 15595275    1 -------------------------------------------------------------------------MQSL--- 4
gi 15596866    2 KNFFKKvgaFLRKTWVWTLLLVLLAALLVWFVGPLLAVADYKFWesptsrlLSISLMFLVWGLAMVFVSWRAGVRRKav- 80
gi 16763668   51 IALLLMllvLWLVNWSMSIIGISVLCLAIGFVTPLLALGDVHPFaplwvrlTLIGFILLMYALYGLYRLWRALRMDEqll 130
gi 15600891    9 VRRLKPt--VVAALPILLFTTFILLNVAIWWAGPWLEVAGYKPLesimarvVASSLFTLGCLAVWGI--WQWRKLQA--- 81
gi 16120846    1 -------------------MLYCVVDRAADRHWPLFPSGGVWVRkiiialiLFWALWPFVAIFFSWIFRYARAPLPK--- 58
gi 16121754    2 KRIALPikkPEVWFWIVALLFLLAGAVLCWLVWQHPERVGLIPGtpqrdrwLTGLVVGTGILTLCALLSYAGTRLSG--- 78
gi 16122928   54 ILLALLlilGFWYGAPRFVIAAVVACAAVWVIGPFILVGDDHPLtdgirrgIIIAIIAFITLIYGTWCLVKALAKNPa-- 131
gi 13472148    3 ILRFLWa--VITSRFLWTLIGIALLSLLIWVFGPIVQVGQYAPFesdnvriAIIAGLIILWLIWLII--AQRRAIRAnrm 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984   69 lEGMLEQAADKSAAPDKREEVEALRVRLAEAVKTIKRSKLGQLs------GDAALYELPWYIVIGNPAAGKSTAVLNSGL 142
gi 15890651   87 --ELVDSIEREALAN-RQAEIGEIQTRLKEALALLRR--VTKK-------RFGYIYDLPWYVIFGAPGSGKTTALTNSGL 154
gi 15595275    5 --AEVSAPDAASVAT--AEELATLKQRMDEALALLKRAKLGGS-------ERRNLYELPWYVIIGPPGSGKTTALMNSGL 73
gi 15596866   81 -eDSDEGQERLRRDGLIEDEQKELRSRFKDALRTLKTSSLYRGr------SERWRNELPWYLLIGPQGSGKTSLLDFSGL 153
gi 16763668  131 rRFLHPRGEEVPVAGEIKADLRTVNHIVTQAIRQLRQLRVDMPgwrkifeGKRFLYELPWFMVVGSPGDGKTTALLNTGL 210
gi 15600891   82 --FKSEQKREEQLRQ--DPIKVYEQRQEVELNQVMLNMKQSLN-------KHNYLYALPWYLVLGLENAGKTSLINRSGQ 150
gi 16120846   59 --RKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRR-------KRQYIDAKPWFLVMGPPGCGKTSIVYESSE 129
gi 16121754   79 -RKHFDELRQQAQGD--DAPLPEDNAQAGETQQGEPSRLKTR---------LRRRYGLFWR--------DKVRLLMVVGE 138
gi 16122928  132 -LLDNFIKHKKAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPawrrffiSNRWRTELPWFMVVGMKGAGKTALILSSGQ 210
gi 13472148   79 fVAEIAAPVTEKQLTPGEESVAAVGAKFGEVMAELKRRKLGG---------RKFLREMPWYVIVGPPATGKTTALRQSGL 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  143 QFPFADKGGAVIQGIGG----TRNCDWFFTTEGILLDTAGRYSVH-------E--EDRREWLGFLDLLKRYRPKAPINGI 209
gi 15890651  155 QFPLGDALGENAVKGIGg---TRNCNWWFADEAILIDTAGRYTTQd-----dLdgSSKAGWEGFLGLLRRYRRSQPINGA 226
gi 15595275   74 DFPLAAQMGAGAIRGVGg---TRNCDWWFTDEAVLLDTAGRYTTQd-----sHaqVDKAAWLGFLDLLKTQRKRRPIDGA 145
gi 15596866  154 EFPINRIDRKLTRDTAG----TRYCDWYFADHGVLIDTAGRYLTQa------DgeVDGGAWATLLGLLRKRRRARPLNGV 223
gi 16763668  211 QFPLAEQMEQTSRILTVpgggTLHCDWWFTNEAVLIDTAGRYARHddggeasAaqRNAGEWQGFLGLLRKHRPGAPLNGV 290
gi 15600891  151 NFVFSSVMRASGQKSEN----PYSFDWWIGDESVLIDPDGELLTQgnrseenDgaLERRLWLHFVDWLDRTRSRRPLNGI 226
gi 16120846  130 KFLLSEQYGLAQTTDIGp---TQDCNWWLTDRAVYIDTAGEWILLh-----gQseEAGTARQKLFSMIRKYRRYPGVDGI 201
gi 16121754  139 --PDEIAALAPQLAEQG---------WLEGQRTVLIH-GGSLQRP-------AdeTGLSEWR-------KLRRGRPLDGI 192
gi 16122928  211 DFPLPEQLNRIGKENPP----TQHCECLFSNDALFLDTSGKYIDDs--------kDNQTEWTGILKALKKYRPVKAINGV 278
gi 13472148  150 NFPIDLTDDLQGVGGT------RNCDWFFSENAVLIDTAGRYVQQe-----sQpdVDAAEWLGFLDLLKKHRGRRALNGV 218
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  210 VVTVSVSELTQNRPEFAINLAKNLRQRVQELTERLEVFAPVYVMFTKADLITGFTEFFGDSEKQERDRVWGASLPFEPDA 289
gi 15890651  227 LVTLSIPDLLNRDPEEQRQELRSIRQRLSELDEYLHARVPVYIVLTKADLLHGFVEFFDGFNKTDRQQVWGTTFKLDESY 306
gi 15595275  146 FIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREERAQVWGMTFALDDGK 225
gi 15596866  224 MVSIPVETLLSDDEMALDTLARQVRARLQEIQQTLHLDLPVYLVLSKADQLLGFDEFFDQLSREESDQVLGTSFGKEQNG 303
gi 16763668  291 ILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRTLTSHLRAQIWGFTLPYSRRR 370
gi 15600891  227 VLALDVAHLATATASERKAYANLLRARLRELMETLSTRLPVYIALTKLDLLHGFEPFFKHYTKSQREEVLGFTFSMDSVD 306
gi 16120846  202 VLCLDVSVLLNSSVTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEKG 281
gi 16121754  193 VWAMTAAQSGTPQWMDN---G--LRT-LEKMGAALRYQPPVYLWQVCDSDWP---Q-----D-SRTEQPVGAVFPAKATP 257
gi 16122928  279 IVAISASDILGKSKADLLNVSATLRTRLDEVRAVLGVRFPVYVTITKLDQISGFDEYFRNLTAEDREQIWGVTFPYNEAK 358
gi 13472148  219 IVALSIDALSEGDEAIK-AHGRKIRRRLAELNDRLEIRLPVYLMLTKADLIKGFEAFFGGLSTSAREQVWGTTFPLDARV 297
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  290 KP----DVAALFDQRFDELCDGLKEISVAQISLHQKNKLSPGLLSFPLEFA-SIKPALRAFLVTLFDE---NPFQYKPVF 361
gi 15890651  307 SAe---NLPQRLTEEFELLQQRVDAMLIERLQQEQNAEIRGRIFRFPAELA-RLKDRLHEALAELCAS---SPLIEAPLL 379
gi 15595275  226 SAe---GPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFA-ALRECLGEFLNGVFKP---NPYEERPLL 298
gi 15596866  304 T------DVTVLRQAFEDLLRRLNSQVIMRIHQERDTLRRGRILDFPHQLG-QIGERLCLFVELAFTG---NRYQRASRL 373
gi 16763668  371 KAgdpqALHAACAQELARLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREFA-ALGEPLLEAIEQIFLDskfDATQLNNTL 449
gi 15600891  307 NLd---SWLEEFASEYTQFVSRVNGMLPHAVAAPMTLEERNAIYSFTRQIS-GLKEILQQFFQEALAS---DQFSTSALV 379
gi 16120846  282 Q-----NNFVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLG-ALQKPLFGLFEQIFPA---TPIGYTGCL 352
gi 16121754  258 E--------KV-EQQLRALLPQLREQGMQQLSIEPHH---DFLLRLAQSLDqGDAARWRQRLTPWFT-----EYAARIPL 320
gi 16122928  359 EQsd-mPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFR-MLSQRVTEVLQNVFFAsrfDETKFHTTL 436
gi 13472148  298 N-------AGMIEAELARLGTELERRLVPRLEDEDKLASRAEIFRFPAQLA-SLRGPIQVLIEAMFGE---SRYEEAAWL 366
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  362 RGFYFTSALQEGATNSASAERIARRFGlsTDgAAR--------SREVFSKNG---------------FFLRDLFSKVIFS 418
gi 15890651  380 RGVYFASGTQ---PETEKSPAASR------------------------TRRS---------------YFLSRLFKDVIFP 417
gi 15595275  299 RGLYFTSGTQEGSPIDRLIGSMAQSMN--LD-RQHl-------ARQTGTGRS---------------YFIERLFREVAFG 353
gi 15596866  374 RGFYLTSAPHLAQQLDEDTAGIGANLG--IAsGl---------LPTLRNGRS---------------RFIHHLLSQVIFP 427
gi 16763668  450 RGVFFTSAAQAQADAVADQLSIWQRFV--RAiKTArgessaslPHALPDGNRs--------------YFLHDLLTQFIFR 513
gi 15600891  380 RGAYFTSVYQQGVPTNAFDDAASRRYG--LS-HAIn-------TAQRAKNSTv--------------YFTQKLFTHIIYP 435
gi 16120846  353 RQFWFGSTQNLTSWEALYYPSSTSTFE---------------------SRPAg--------------QMYFPALSQAITE 397
gi 16121754  321 RGLMFSLPDT--------SASAAQ-----------------------VHEKS---------------WTVPASWQGVLDD 354
gi 16122928  437 RGIYFVSSCQPADVELLNNNTLIQKWRnvINhKKPl-------SPADLSQKSdnedrfisdvaygkqYFLKQLFSDVITK 509
gi 13472148  367 RGLYLTSATQEGAPIDRLTAALSSSFG--LPpRRAm-------PAARVEKRS---------------FFLRNLLTEVIFK 422
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  419 DRQTVRQF--ASPAKTRLRIATFFGLVLALGLLLGGWTWSYMGNRTLTANVQADLDKIVK-------LQQNRVDLQARLE 489
gi 15890651  418 EAALVTRDkrLSRRQLLVRRIAYAVSATAVAIVFTGWIFTYFANTQALAEADRKLGAYEQlvqgipvREVADADFLRILP 497
gi 15595275  354 ERGLVGTNpkVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARgi---esLSPAQRDVLAVLP 430
gi 15596866  428 EANLAGLDrrERTRIHWGQRALYVGSLALLLLFGLLWAGGFSANHERLERLRELAQQWTQq-----rQALGERDDAMAAL 502
gi 16763668  514 EAHLVEPNlqWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDYLNEISARATRLDGdv----kAYTGKPAMAPVPA 589
gi 15600891  436 EAGLASDNfrVAKNKRRLMGLSFVACSVATLLLAGTWHRNYLNNVQHADTVLTKVNQYKEqf----pTSRSLASQREVLD 511
gi 16120846  398 RGVLHATGp-MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRR--------IVRDIPITNQVN 468
gi 16121754  355 CRGARGRR----VGLPWEQTLCYSLLALIVLWGVG-SVVSFAVNRHQMVSAAQQAQQLAQsh----aVSDQQLMALQALR 425
gi 16122928  510 DADLVSYNlkVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQATGAKLSQLESt-----vMSYAKTSNEQILP 584
gi 13472148  423 EAGLGTFDplAQRRRAWIWRGAAAACALAALLAGGLFTWSYLDNRNAITEQAGQFEALQGp-----lTQVAATPAAVEQP 497
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  490 -ALDILQDRIEQLERFRGEHPLALSLGLYQGDALQHKL----LDEYYNGLRQVMLKPVGGALETFLAEvnthpeqlapmv 564
gi 15890651  498 -ALDNLRDVNSGFARERVWN---VSFGLDQEDKIAGRQ----RDAYQRALNALLLPRMIVQLQKQLK------------- 556
gi 15595275  431 -QLNAVQNLAGDAPSWAEGY-----G-LYQGDMLGEES----ASVYRKLLIAVFAPRLVTRIEEQLRS------------ 487
gi 15596866  503 kTLDSSYAATTVFPPKGEVS-LHERAGLYQGNEVNPPL----AAAYRRELETQLLPRVARMLEAQIRG------------ 565
gi 16763668  590 -LLDSARELSAWPELDPDAPPLAWRYGLYSVPPVTDSV----ASLYNRLLDQLLLPPLVKRMEYVLADa----------- 653
gi 15600891  512 -PLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPKV----EETYLNLLETRFLPLLMADTIVALNQ------------ 574
gi 16120846  469 dNLVAAYEQLGYINTHYLESSPPLLTPYFEHRLLNQAM----LQTYHRHLNKVFWPAVQNYVTNELKKd----------- 533
gi 16121754  426 nDIGRLQSRVAQGAPWYQRFGLDHNAPLLEVLMPWYGQa--nNRILRDATAQSLYQKLSELAELPANSp----------- 492
gi 16122928  585 aLLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGA----NTLYQFFLQKYLFPMVENQSEVTLRKt----------- 649
gi 13472148  498 -TMDGALAAMDAVATARTPPPDAVHN--LLGPTASPELvraqTDTYDHALRNVLEPHMVALLEATMWR------------ 562
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  565 rppetgaviatsvtsatatiaasgaaagapasasptatataaapagkrftdaSPSNVEDGYNALKTYLMLSDKRHVEVAH 644
gi 15890651  557 ----------------------------------------------------DEKDVTRTFNSLKLYGMLGGMGGLDRDF 584
gi 15595275  488 ----------------------------------------------------GGSS-DFLYEGLKAYLMLGSPDHYDADF 514
gi 15596866  566 ----------------------------------------------------NMQNRERLLNSLRAYLMLNLRERRENGW 593
gi 16763668  654 ---------------------------------------------------iARQDSKAAYDALRIYLLLNLDK-DHEDK 681
gi 15600891  575 ----------------------------------------------------AETD-EEKLAVLRVYRMLVDKSGRYQDY 601
gi 16120846  534 ---------------------------------------------------tQSPD-GDNYDTLKVYLMLGQPDHRSQEA 561
gi 16121754  493 ---------------------------------------------------qRAARAKTGYDQLKAYLMMARPEKADAVF 521
gi 16122928  650 ---------------------------------------------------mHSGQSEEVYAALKLYLMLTGEGKFDRQY 678
gi 13472148  563 ----------------------------------------------------QIRDPDFMLGALKTYRMMTGLSQMDTDF 590
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  645 LTDQITRFWRGWlEDNRGNMPREQMIRSAER--NLSFFLARVNDDN--WPLLEGNLSLIDQTrenlRRVVRGMPAR--ER 718
gi 15890651  585 LTTQTHQMFASL-YPGDGRAAAREALDQ-----HAKALADGVLAP------IELDARLIATA----RETIRDQAIG--TR 646
gi 15595275  515 IKAWISLDWERN-LPRDLSPEQRQALHA-----HLDALLERRPPSArlDQDLVEDLR----------RQLQQLPVA--QR 576
gi 15596866  594 LKDWVATDWSQR-YAGNGTVQN---GLNT----HFARLLEQPFSY-------PLNETLVAQA----RQVLRSESLA--NV 652
gi 16763668  682 YNAAEIQSWVINdLGNSDSVAGFGGRAAVLT--HIEALFDGSRVVH---SPYEKDEALIRQA----RAFLDGHTST--ER 750
gi 15600891  602 VMDYFAKYWQKS-FSGQRQIQEELLGHLDYAmrHTDLTAERLNGDKgaEQVMRPYDKVIARA----QVELGSMPND--QR 674
gi 16120846  562 LVQWFMSRWESFaPQGYGQNDRK---LFSy---HLSELFSDTASA---APKVKLNDELIRES----RIKAMKTPIH--IR 626
gi 16121754  522 YAQVMQTTEPTR----AGVSPGLWQSLAP----DLWQFYAQNLPAQp-DWKITPDTGLISQVr---QVLLGQMGQRnaES 589
gi 16122928  679 MIEHVTQDWQKS---GKIEPYEEKSIFVG----HLNTLFTLKDWR---QYGQPADSELIKQA----RAILAEKTVT--AR 742
gi 13472148  591 VQNW----WVNS-LP-QFAPAPPFPTAD--AeeHQIAAIRRMAVD---DSYIAPDKALVAEA----LKTVCTISLP--ER 653
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  719 AYAEIK-ARASTRYAPMTVARIVGE-TGGNVIAGS-------YAVPGTFTKEAWQGYVQPAIrEAASKELQTKDWVLNVA 789
gi 15890651  647 AYDILAgLPQVRELMEWTPATAFGP-LGERAFERRska-pmaEGIEGLFTADGYRRVVIPQV-AHAARVALSEGWVRGSD 723
gi 15595275  577 VYDRVKrQRLPKDVPDFRISDAAGR-DAPLVFARKsgk-pltDPLSGFFTYRGYREVFLTAS-LSQAGTIAEEQWVLGRD 653
gi 15596866  653 VYRVLR--EQARSLPEYRFGQHLGP-QAGLFVGTD-------YVIPGFYTQQGYQQYFVVQG-ASLVNDILRDNWVLGEG 721
gi 16763668  751 IYARALaAMESEAPQEFTLVRAVGA-DAGTVFVRSnga-pldRGVPGIFTREGYRELFDKRLpEFVAAATANDGWVMGRE 828
gi 15600891  675 VYRNLKlSAQTVLGPSVNLRSLIGP-VFDVVFEERvln-sssLFIPQMLTKRGFDDYFMPQS-ESVSELALIDSWVLGQS 751
gi 16120846  627 VINRIHdAPLPARIEDLSLADAAGP-SVTLMLRRKspstvtdLAIPAFYTRASYHDVVNPQLqEASEAMINEEAWVLSDG 705
gi 16121754  590 TLYENMlLSVRRNYADMTLMDMTGDtDAQRLFQTS-------ESVPGMFTRKAWDEQIQQAIdKTVASRREEIDWVLSDN 662
gi 16122928  743 LWGRIQsRLLADAPANMTLRKMVGE-HATQVFTLSdde-llhEGIPGLYTYAGYHEVVKKKLtPLLMLLQEEDRWVMAQS 820
gi 13472148  654 AYKQLLaDPEVAALKEWVPANFAGP-NGAKVFARRsdk-tlrVGVPGPYTYAGFHDAILDRV-EDVAGQAALDRAVFAGG 730
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  790 ARDDLTLEg-------SPEQIQKTLVTMYKTEYAREWQRFMQGVAVQ--------DFTSFEQAVAGMNLLGDPTnSPIRK 854
gi 15890651  724 DAIKG--A--------TVEQVAQAALQIYFDRFEKIWADTLSDLRVK--------PSQSLGDAVETTRALANER-NIVVE 784
gi 15595275  654 LNDAG-----------DAANLALDVRRLYFQDYLRQWDDLLADLTVV--------PITNVTQAADVLRILSGPT-SPFRK 713
gi 15596866  722 SGISDm----------DLRRLMVELEQLYFRDYANFWSEAVGRLGLL--------PFNDAGEGADQVSGLLAAN-SPILQ 782
gi 16763668  829 STPKKLTDslrsqipgQEQSVAREVRRLYLTEYARRWQDFLDSIHSInsa--geeGSSGLAYDLQVLRTLASPD-SPLMR 905
gi 15600891  752 KTAQFSEA--------DKQALREKIRDLYVADYTNTWRAALNEIDVK--------YFNDINDAVMVLENITSNL-EPMQR 814
gi 16120846  706 KASVSQVSll-----aAAQKLSDEARKYYLMEYANQWDAFFNDIRVR--------PINGLDDAALLARQLSDPS-SPLAN 771
gi 16121754  663 RRAISEDI--------SPEALKKRLTERYFTDFAGSWLSFLNSLHWN--------EAHNLSDVIDQLTLMSDVRqSPLIA 726
gi 16122928  821 LSSSL-----------DPLTLRQDVLVMYLQGYAAYWKRFLSSVRLIsvdadsaeYAQGLSLDIALLRTLVSEN-SPLLN 888
gi 13472148  731 CSENS-ET--------SVSALSQDILKLYYDDYIAQWDSFLRDMRLA--------PLTDLNIASENLKDLSSAD-SALKR 792
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  855 VLDTAYDQTSWD-------NPSMLNAG--LKQAKSGVLGWFKQLFARQ----TPSQINVNVDVGGNTETGSIPMGPVGKE 921
gi 15890651  785 AARSIAEATDLRpga--npAALASAAEgdATAAVLAATVNAADPYARLrdmlATKGAATTGEQPNGDKTGGSPSEQLLAH 862
gi 15595275  714 LLEAVARETDLQk------GDRLVAAQ--VKKAADGTVDKLKQRLGSLv---GQEEEGAREQP---RQVDSDP---ISAH 776
gi 15596866  783 LLLEVRENTRFP----------VLAES---AEALAEASDKAAEKGGKLg--kAAAAAAGKARDALAKNLPDTAKKSLQRR 847
gi 16763668  906 LGKAVVEQTTLVp-------PPDPQAR---QKQLAQRASGNAGKVVQT----AKLFQDIHPEERLEKTLVDDR---FAAL 968
gi 15600891  815 LLRTLDDNTQl--------YSALPKDEsaLKELLKSPKYKVASMIETPf---ADLNGMLKPVGS--KPAYMTE---VLAS 878
gi 16120846  772 LVRFSTREIT------------LTTDN--NGKGAMSSGWFNIQRNKLT----TARRNIIDEMSGERSRFRLTPEKAVEDR 833
gi 16121754  727 LMNTLAWQGQTGqqnqalsDSLVKSAKalMNKDQAPAIDQSAGGPVGPldetFGPLLALMGKGDAQNRLSSDSSLSLQTL 806
gi 16122928  889 LARQAVKETTLAe------KEKAITDE--INIRTQGQLLSQAKKLQETi---AFRENKLIKEWVD-NRFESLR---VFVN 953
gi 13472148  793 LLTAVVQETDLTr------SDDAPADD--KSGAAAKSGSKLLSKLGKLgk-vVTSGAKLLPRAGSANQVDMTGSL-VADH 862
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984  922 FAGLARVAVMHDDk-SLLRGYMDALSKVRTRFNLIKnqgdpGPGARQLMQQTLDGngseladtlkyvDeQMLTGMTDSER 1000
gi 15890651  863 FKLLNEQLARSA------TTSDEVAKVFDVDSQLT------KAN-QDLLQQ------------------------ARELP 905
gi 15595275  777 FAELNSLVSKGEGg-NEPAPIDSLLEDMNALYVQVSamagaSGDSLLGDAKNQVAaa---------aS--RV-ALSAERQ 843
gi 15596866  848 FEPLHRLLDDNNGpaADLTPLLQALNELQLQLAGLArasqpEQAAFDMAKSRMGGqr---------dAlSNLRNASARLP 918
gi 16763668  969 REVIAGRTDGGQSg-GGTMQIASLLTMLNEYYTQLT-----IADSALAAGTLPARi----------tAaDKLQLEAAKLP 1032
gi 15600891  879 VDELKSYLKSIQ---DAPDVGMAALDATKARVKLV------NADPIYTLKR-----------------------ISSGLP 926
gi 16120846  834 FELLRRLGYALQS--ASTSNSDPLGRTFEQIYNQLIt----LSTSLRAGQILPQNn-----------DfSRLQIDMARQP 896
gi 16121754  807 LTRVTRVRLKLQQvvNASDPQEMTQVLAQTVFQGK------SVDLTDTQEYG---------------S-LIAASLGEEWS 864
gi 16122928  954 GEQSADVTGGNNLsvLQGTQMSRIIGTLNDQYTRFV-----VYNSAFEYGDIPPLs----------qDgERIAVESQTWP 1018
gi 13472148  863 FKPLKGTIAQVD---GQPPALDAAVVALTALSNVLQtv-taNPNPQDAIKKQGGLae---------lTgAVA-RQAQILP 928
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984 1001 QTLRPLLVRPLLQSYAVVIRPASV-EINKVWNAQVYQPFSQTLAEKYPFAANAKIEASAAEIGQIFGPE-GAIAKFANTT 1078
gi 15890651  906 APLDVWVAGVAADVGSLAVKSARS-RIAELWTADSASLCSSIVTGRYPFDRASSRDVAIADFTRLFAPT-GVFQSFFKQR 983
gi 15595275  844 PPVVQGLVKNVVNSTTSSMMGSVRnQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFFGAG-GVMDSYFRQY 922
gi 15596866  919 RPLGGWFSVLAEDAWRLVLGDAYL-YLNQRYQSELYGFYSKAINKRYPFNAHSASDVAVSDFREFFKAQ-GVAERFFETY 996
gi 16763668 1033 APLKNILLDLTKQGTRKINAGTGD-VLNTQMEAMMGDDCRDAIDGRYPFAD-SPQEVSAEDFNRIFASG-GVLDAFWSKQ 1109
gi 15600891  927 KPLDSMMAKLADESWYVVKQEAIK-HLEVRWTEDVYKTFQSKLAGRYPFNPASNKDVALADFEAFFAPN-GTLDNFYNQQ 1004
gi 16120846  897 EPVRSIMMDLLAVGQTQSLQQSKA-NLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRS-GAMQSFFDQN 974
gi 16121754  865 SFGQTMFVQPLTQAWETVLQPSSA-SLNDQWKNAVVANWKSAFDGRYPFAA-SKSDASLPMLAEFIRKDsGRIDSFLTRE 942
gi 16122928 1019 DPFRNIIAPLLTGSSQKFENKVIT-HTSKAIDMGVGEICRNTLQGRYPFAE-SEQIVSLNDFERFFGTD-GTVDSYFKKN 1095
gi 13472148  929 SPINEWLGGIAGDTSGLSQKAVTN-ELNAIWRADILPFCQAALNNRYPFSPDSAVDVNVRDFQRLFGPT-GLIDAFTTDH 1006
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984 1079 IGPLSVRRGDMLAARTWGDLGLAFVPEFTAGFTRWIAPLTGGAAGgaggaAAAAPQTVFQILPVPS-QGTTEYTIEIDGQ 1157
gi 15890651  984 MEPFVDKTTTPWSWK-GTFGAAGIPSSAVAQFENADKISRAFFPN-----GSETPTVSINVKPVSLtNASSAVMLEIEGE 1057
gi 15595275  923 LQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRS-----GGMQPTVRFELKPVTMdAAISQFILDLDGQ 997
gi 15596866  997 MRPFVSGDPGSYRLRSVDGYSLPMSKVYLDQMGTAQLIRQSFFAE-----NPAEPQVRFRLEPYTLdPGVSRAEFRFDGQ 1071
gi 16763668 1110 LAPLADTASDPWR-YKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSe----GGKKFSWSMQISVVDMdPAIMELVIDIDGQ 1184
gi 15600891 1005 LKMFIDENISVA---SDDSAQSIIRKEVLDQIKQAQKIREAFFNR-----KGILD-VSFSVEPLSLsNNKRRSVLNVDGQ 1075
gi 16120846  975 LAPYVDTNGNRWK--VKPDSNGVVTPKTLRSFENSAQIRDTFFD------ASGKMAMSMIIRPISLtPSILEAVLDVDGQ 1046
gi 16121754  943 LGGVLHKEGTRWVPNKVNSQGLTFNPAFLAAINQLSQISDILFTD------GSQG-LRFELLARPV-PNVVETNLAIDGQ 1014
gi 16122928 1096 LESKVDTSSIPW-----RYKG-SVSSEGLAFFEQAAMIRNVLFNTn----DGKKMALDFSVSVRYLaPTITQLIMNFDGN 1165
gi 13472148 1007 LINYVDTASEPW----KWRADFGLDPAALAAFEQARHIRDDLFP------GGTGPVMNFTLEPKDLsPNVARVTLNLDGQ 1076
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548984 1158 QLRYRNTPPQWANFVWPNPQGAP-GARVTATT-FDGRTVELLNEPGRFGLERLIATANRK-RRPDGAFDLTWARGDIS-V 1233
gi 15890651 1058 RVVYYHGPIQAKSITWPSRENTAsLSRIAFQP---GGWQQAKTENGDWSPFRLFDGANIE-NQSGELLRVRFENGVQA-A 1132
gi 15595275  998 QLTYDHGPSRPVAMQWPSANGLG-VVRLTVTP-PPSSGRSGLTLEGPWAWFRLLDQSDLErGNSPDRFTLRLRIDGSS-I 1074
gi 15596866 1072 SMEYRHGPIVPMSFKWPSDADGG-RTSLVLEK-MAGRPVGIERNTGPWSLFRLFDLMQTEyLSGRDVMVLKADLGGLR-A 1148
gi 16763668 1185 VLRYAHGPDRPLKVTWPGPRNGS-MAEITASP-RIRQDTSTLLTGGPWALFHLLDAGMVQeTAVRGRQLVEYDFDGRR-V 1261
gi 15600891 1076 FLAYSHGPRENVELIWPNTLRDSaVSKVTLIPtQTNMSPRSLQIQGPWAFFRLLDQGDVV-SASQTSVDFKFIVDGGE-M 1153
gi 16120846 1047 IINYSHGSNQPVKVDWPGPKGGV-YIRLTFKT-QDGN-VETVSFNGPWAIFRMYDVSNPR-PLGVNSRELMMVMDNVS-G 1121
gi 16121754 1015 KLHYFNQMESWQSFRWPGETYKP-GTMLTWTG-VSSGARLYGDYQGTWGLIRWLEQAKQK-KLDEGRYQLTFTTADKQpL 1091
gi 16122928 1166 TVRYSHGPVTPAFFKWPGLRQGT-IVSLTAQR-QKASAMPDILFRGPWALLQWADQADEIrDEANGKQTLTYLMGKDR-V 1242
gi 13472148 1077 NLVYYNNATRPQPMTWPGKDGTG-VISLAFQP-VDGSPEVMLNETGSWAWLRMLRGGRFAaTKLTDVYSLRLGTKGMW-A 1153
                       1370      1380      1390      1400
                 ....*....|....*....|....*....|....*....|.
gi 17548984 1234 SVSLRIISSPQtagtsgsdSPQGQGLRGLRLPTSiadatAS 1274
gi 15890651 1133 EFDIQFGSVLN--------PFKLDAIASFACPAQ-----F- 1159
gi 15595275 1075 ACELRASSAFN--------PFKSRVVSGFSLPER-----L- 1101
gi 15596866 1149 NYLLLAQRTPN--------PFDLAVLRSFRMPVQl------ 1175
gi 16763668 1262 VLEITAGRDFN--------PVSRELLQNFSCPAR-----AL 1289
gi 15600891 1154 IYRINAEADAN--------PFTERLFKSFKLSKT-----LY 1181
gi 16120846 1122 VFKIELSSTMKd------yPLWSKALAQFSCPKN-----L- 1150
gi 16121754 1092 QWILRTELGKG--------PLGLLQLRNFTLPAQ-----IF 1119
gi 16122928 1243 ELEVSGLTHGG--------ETISDLLRDFKCPSVndmngIW 1275
gi 13472148 1154 DFELKAASVEN--------PYTLEMFKKFTCPPQ-----I- 1180
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap