Conserved Protein Domain Family
COG3521

?
COG3521: COG3521 
Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and vesicular transport]
Statistics
?
PSSM-Id: 226052
View PSSM: COG3521
Aligned: 12 rows
Threshold Bit Score: 152.126
Threshold Setting Gi: 16120843
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548962   1 MAVIaltacsTGASVLAGAASGAleaVGLk---ASNVPDa---qKP----------PREVPLKLTAGANLNAAT---DRR 61
gi 15829480   1 MN--------RKAFLACVLMCVIl--TGC----ETAKKIsevikNPdiqvgslkeqPSEITVTLLTEPDTNTNA---EGE 63
gi 15595278   1 MQ---------KLIVALFGLLLA----AC----SSSPPE-----TP----------PTRVVIWLHAAPNLNPSA---AGQ 45
gi 15596863   1 MSRRpi--ppARALAMLAVLALL---AGC----STLSPY-----SR----------LTKLDLALSAGERVNPDL---NGR 53
gi 16763663   1 MNEWrnptrwLCAVAMPFALLLL---SGC----GSSDAL------Pdl-------eSQRLDLSVKASDKVNPDN---QKK 57
gi 15600884   1 MN---------KVLWMLFALTVL---TAC----SSSDKY-----EPak-------ePTKVTFSLVSDEGVNPNI---WGE 49
gi 16120843   1 MRS-------LFRVLPIFILTGCvllSGCswfsSSSEAA-----LQ----------KRRIDLQVVAAPLINPGP---NGQ 55
gi 16121760   1 MLLS------GCGLTQAVTDSTV----------SATKSLf----YKq---------IKVLHLDFTAREALNTDAheaNSS 51
gi 16123121   8 MNKSir--gvYRATQYLFLVLVTlltIACs---SKVQPEk----------------AEKLTVEIATAADINPND---KGV 63
gi 16123738   1 MNN-------ARGYLLTWALCVVfllSGCsgawEATKKVgkvvmDPdipvgqatdqPSTVRLTLLSDPDTNPNE---KGE 70
gi 15799906   1 MN--------RKAFLACVLMCVIl--TGC----ETAKKIsevikNPdiqvgslkeqPSEITVTLLTEPDTNTNA---EGE 63
gi 13472145   1 MIDR------REFVVALGATGLL---AAC----QSGPPK-----------------PSVISVNVTGGAGMNPGP---GGG 47
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548962  62 PVALVVRLYALKDPTSFLQAPYDTFIDParEKQTLGADLVQVREMTLIPGQRYEFSEK-VSREASTLGVVALFRSPAAQR 140
gi 15829480  64 SAAVDVQLVYLTDDSKLQAADYDQIASTp-LPDVLGKNYIDHQDFNLLPDTIKTLPPIkLDEKTQFIGVVAYFSDDQATE 142
gi 15595278  46 AAPLRLRLYELKKDTAFGRADYFALTDN--AQSTLGGDLVEQDEFLLRPGEERRIERT-LDEQTRQLGFVAAYRDLDRAT 122
gi 15596863  54 PSPVVVRLFELKHPVAFENADFFSLYER--PKETLDPDLVTSEELELRPGERVELKLS-VEEGSRYVGVLAAYRDLGEAS 130
gi 16763663  58 AAPIEIRVYELKNDAAFTTADYWSLHDN--DKSVLTDDLVRRDSFILRPGEEKKLRRP-LNAQTTAIGVLAGYRNLAKSV 134
gi 15600884  50 ASPIEIQVFELKDDSMFMSSDYDQIKTD--YKKALRSNFVKNYDYVLTPGQFKFVNAFeVDEETNYIGVMAHFAEPELSE 127
gi 16120843  56 AQPLKVCIIELNKEGWSPPGLYQGTLCS---GISVGGEVVSVTEYILAPTEVRQYSRDvPFEQERWWAIAAEFQEMSNGK 132
gi 16121760  52 SEPVMVRVYQLRDDKTFLKTVYQQLASD--GEAALKDDLLASRSVVVKPGGAVTLDMP-MEKETQFVAVVALFRHPDMAK 128
gi 16123121  64 ANPLRIALYTLKSTDEFQSSDFFTITEEn--TPSLKEQMDNVFDRIMLPSETKKIELT-LDAGVTAIGIVAAYREIEQAE 140
gi 16123738  71 AVPTEIVVVYLSENSKLLAADYDQLSSDa-LEKTLGKNYIDHQEYTLLPDQFKALDPIkLEEKNSYLGVIAHYADANRSE 149
gi 15799906  64 SAAVDVQLVYLTDDSKLQAADYDQIASTp-LPDVLGKNYIDHQDFNLLPDTIKTLPPIkLDEKTQFIGVVAYFSDDQATE 142
gi 13472145  48 DRPVTVLVMRLASTGKFNSADYFALQGD--AGSALGADLIGSDAISVAPGKTAAKTIT-VEPNATALGFVALIREPGGRN 124
                       170       180       190
                ....*....|....*....|....*....|....*....
gi 17548962 141 --WKFAFNAEKNEkSGIMIGLHACAmtlTTGSPTTPAGS 177
gi 15829480 143 --WKQIETVEGT--GHHYRLLVHVR---QSSIEMKKEDE 174
gi 15595278 123 --WRQVLDVPGQR-TSHLDITLGAQ---AIGIVARPAP- 154
gi 15596863 131 --WRYVVPVTAKE-LTRVELKLGQKgilNAGELLGKAGD 166
gi 16763663 135 --WRVTYKIPEAPeKAWYSSFISGKgkvQLEAELEQSAI 171
gi 15600884 128 --WKKAVKVINK--GREYHLLMLFK---DYDVKLDRVE- 158
gi 16120843 133 --SLLTLKSDAR---ADFNRVVLVDg--KALSLKASTK- 163
gi 16121760 129 dhWRLILTLDDLHpDKPRTLELGNN---SLTLRTEKK-- 162
gi 16123121 141 --WKAVIYPLPKKrVDPWYKKMWPGqdqQDPIMKVRVER 177
gi 16123738 150 --WKKIIKIKGI--GHNYQVLVHVR---SNDVDLRKEEE 181
gi 15799906 143 --WKQIETVEGT--GHHYRLLVHVR---QSSIEMKKEDE 174
gi 13472145 125 --WRTTKSVSPG---SKFTINVSLG---KGGISA----- 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap