Conserved Protein Domain Family
COG3519

?
COG3519: COG3519 
Type VI protein secretion system component VasA [Intracellular trafficking, secretion, and vesicular transport]
Statistics
?
PSSM-Id: 226050
View PSSM: COG3519
Aligned: 13 rows
Threshold Bit Score: 592.784
Threshold Setting Gi: 15596857
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16763650   1 MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSARTQLKIDAEFPRFTQRLLEVVS 80
gi 15890646   1 MADGFLEKYNDELFALRKRASRFAAAFPKIAGRLRMTGDVADDPHVERLIQSFAYSAARVRQKLDDEFPELSDSLLETLY 80
gi 15829483   1 -MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEK---DADPDIERLLEGVAFLTGNLRQKIEDEFPELTHGLIKMLW 76
gi 15595286   1 MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPYVERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAY 80
gi 15596857   1 --------------------------------------------------------------------------MMHLLW 6
gi 15597565   5 IDADLLDYYQRELTWLRHAGGAFAERYPKVARRLQLAPGECPDPHVERLLEGFSLLTARLQRRLDDDYAEFSDALLEQLY 84
gi 17548968   1 -MEELLPYYERELAFLRRYSRDFAERYPKIAGRLAMSGDGCDDPHVERMIESFALLSARVSKKLDDDYPEFTEALLEVLY 79
gi 15600881   1 --MTQDKYFREELAFLKEQGKEFTEIHPQLSRFLHGR---TTDPDVERLLEGFAFLTARLREKVEDEFPELTHSIINMLW 75
gi 16120834   2 PNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDPFVERLLEGTAFLSSRIQQRLNNEHPEFALQMLGRLA 81
gi 16121758   1 MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPELTEGLVSLLW 80
gi 16123130   1 MDHKFLDYYNKELTFMREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPKFTQRLLDIVY 80
gi 15799909   1 -MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEK---DADPDIERLLEGVAFLTGNLRQKIEDEFPELTHGLIKMLW 76
gi 13472142   1 MDRVFVEYYEEELTHIRALAAEFADMHPAVARNLSLDTVPCPDPYVERLLDGVAFLAARTRLKVDAERSRFSRAVLDVLY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16763650  81 PNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPdmPALHR 160
gi 15890646  81 PHYLAPIPSMSVVQFAPSPALATV---QTLARHSEILAEPVGGES--CRFRTTQEVQIAPLQIAAATLAGQP----IDAP 151
gi 15829483  77 PNYLRPVPAMTLIEYTPDMDKSSVP--VLIPRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLCRDIWLLP--VRLEQ 152
gi 15595286  81 PHYLAPTPSMTVVQLRPDPNEGALSSGFSIERGASLRGQLGPDDQTACEYRTAHPVTLWPLEVAQADYFGNPa--AVLGR 158
gi 15596857   7 PNYMRPLPAFSILQFDPLTRPGGA---LRVERD----TPV-----------ESRPVGEVACRFRTCYATEVLP--LVLEA 66
gi 15597565  85 PLALRPLPSCAIVQFEPDPTQGNLAEGYRLPRDTALFVTTRGGDS--VHFRSSAEATLWPLAIDEATLLGGEE-----AQ 157
gi 17548968  80 PHYLRPFPSCSVVHFDVRGAAAQLSAPVQIPRGTFLTSRVVR--KVECSFRTAYDVTFAPVRIAAATYARAVS----APS 153
gi 15600881  76 PNYLRPIPSMSVVAFEPDKSVSEK---QVIPRN----TQL-----------DSKPVFGTACHFNTCRDVALYP--MQCQG 135
gi 16120834  82 PLWYTPLPSIATIAMVPDLTSPQWHSRVVLPKGSRVTLSDSSLNNRLANFSTGRTLKIQPLVIENAECASTPP---AYLP 158
gi 16121758  81 PHYLRTIPSLSIVEFTPQWQGMKER--MGVSKGFEVLSRPIGERETRCRYTTTQEMDLLPLTLRRAGLDSEP-------- 150
gi 16123130  81 PNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWPLEIAEARLSSVPPdmPNLEK 160
gi 15799909  77 PNYLRPVPAMTLIEYTPDMDKSSVP--VLIPRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLCRDIWLLP--VRLEQ 152
gi 13472142  81 PDLVTPAPATAMAVLKPGQQVQSMIAGHAVPRGTRLVSGLNPGLSTRSTFTTAQEVTLWPIAITSVSYFQDRSalAAAGI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16763650 161 YLPPNIHVAGALRITLRTFGE--LTFSELAgPARLPFYLCGEERIASHLFELLHTSAVATLAGEPGH------------- 225
gi 15890646 152 FSASFAGTASCLRLSLRSTAPrgGTFPEMG-LTKLQVFLSAAWQQATALYELLTNHCVGMALARHS-------------- 216
gi 15829483 153 IENRSTTRNGVINITFSVAPG--TDFRTLD-LNKLRFWLGNDDN---YTRDQLYLWFCEYLQGADLT------------- 213
gi 15595286 159 LAASEPRAKAGLRIRLRSGAG--IPFDSLS-LDALPLYLHGADEQPYRLYEQLLGNACAVFVRAP--------------- 220
gi 15596857  67 LNYSVTGEGALLGLRLAMNCD--GHLGELG-LSRLRLHLAGER----YISQMLYLCLLRNLESIQLIpldahgrpldgva 139
gi 15597565 158 ALTGVGAARSALRLSLRCLGE--YRWDELS-IERLRIHLAASPMGCAILYDLLAAHTVQVMAGAP--------------- 219
gi 17548968 154 AVSLPKGATGAIALTLEYVGEr-GGFESLP-LDRLRVYMDGEPSFVAALGDALFLHTAGTYVEGE--------------- 216
gi 15600881 136 VHAEHTREATTIQISLRMLGD--MTVGDAK-LDTVRFYLGGDK----YSSQTLYLWLHHYLQKMTIE------------- 195
gi 16120834 159 LSVASQLQAGQAHLRLRLTTQgvASLSELD-FAPMNLTLAGGIIQSNQLITTLLNNTLHIVLWANTD------------- 224
gi 16121758 151 ----DGRSVIRLRFDCSALAD----WSRIN-LSRLPLYFDADAPLACALHEALTLNTAKLWIRLP--------------- 206
gi 16123130 161 HRIAYHRLKGALRIKLKLVGD--LTFSQLEgLDRLPIYIDGDERIVSHIFELLHASHVATIIRAGHG------------- 225
gi 15799909 153 IENRSTTRNGVINITFSVAPG--TDFRTLD-LNKLRFWLGNDDN---YTRDQLYLWFCEYLQGADLT------------- 213
gi 13472142 161 APIGDARGEAAFRVTLVRTGK--GKLSELS-LDRLDLYFAGRARAP-LLFDAIFGACSGLGARAEG-------------- 222
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16763650 226 FDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTG---LSAGLQKVQGNVAEIVILLNRL 302
gi 15890646 217 EDKEAIFLPAGNLRPSGFTRDQAMLPYPANSFDGYRLLTEFFALPQKFLFLDIDG------LHRWSGGD-CELYIYLDAA 289
gi 15829483 214 VGEQHIRLPEFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCG---CPALPDGLQAEFFTLQLRFSRP 290
gi 15595286 221 DNAWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSG---LNRALRRCHGEELELVVLFGKH 297
gi 15596857 140 GKPMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGldlLGALPEETLKQVRGLELRFDIR 219
gi 15597565 220 -GTPPAALRGLP-EIVGFAADEALLPEEDGGHPGLRLLAEYFAFPDKFHFFDLPL------SGALADGQTLYLYLVFDRA 291
gi 17548968 217 RPGVWTGLSGVPLHEVGFAEDEALIDCPARSHPAYRLLTEHFSFAEKFNFFDIDLaavRRRLTPGVPVRRLVLHLVLKDV 296
gi 15600881 196 VQGVEFALPADAFSTVGFSSDQALLPYPKNVYDGYRILQEYLSFPEAFHFFDVKGf--AKALPKAVSGD-FTLRIHFSKT 272
gi 16120834 225 GKPLVKVLTKEHLRQGGLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGl--NDFLQQGDGIHTFEVLFVLDQR 302
gi 16121758 207 -GQADRQPLDGHFAPLGFGEQDTLWPKADSAFSGYQLLLEYFTFREKFMFVALQG---LDGIELPAELPWFEIDVVLEKR 282
gi 16123130 226 ETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQ---LSQSLRDNHTGEAEIIILLDRL 302
gi 15799909 214 VGEQHIRLPEFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCG---CPALPDGLQAEFFTLQLRFSRP 290
gi 13472142 223 KTNPLTALPEP--EMIGIRDDEALMPRTRPTFEGYRLLREYFMIPERFHYVRVAG---LQSVVRKCDGG-IEIIFLFRRP 296
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16763650 303 PPD----WLIHQTDaAQFSLFCTPVINLFPRTTTRIEVTHSVTEQHLVVDRTRPLDYEVFSVQEVEGLEAETTRKMIFRP 378
gi 15890646 290 DA-----QLERMVSvKDFVLNASPVINLFKQSCEPLSLDGTRTEYRLLPDARRQRTREIYAVEDVQLTSRSGQSEK-TSP 363
gi 15829483 291 LPV----DIRLRRD--SLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQHYDVFSVNSVVSQVQDMFRKKDLGR 364
gi 15595286 298 DQ-----RLEGTVDaEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVIVDRTRPLDFEVHSLQQVSGHGSGP--EQPFQP 370
gi 15596857 220 KSG----IQRLHPTlENVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGVTG-WRPG------GL 288
gi 15597565 292 PTA----RLHLQAE--DFQLGCAPAINLFPRTSEPLRPDGTRSEYRLVADSHRENSVEIHSIRAVRSVAGSTVQP--VPA 363
gi 17548968 297 RSDshaaRLLEGLQaEHLRLHCTPVVNLFQQNADPIRIEHTASAYPVVADSRRAHGFDIYSIDKVHL-VRETAAHE---E 372
gi 15600881 273 LPA----DTRVRQD--NFQLYCTPVINLFEHDADPIDLTGRRSEYRIVPSSRYPAHYEIFSVDQVVG-WQDTQSE---GK 342
gi 16120834 303 PLH-----LIDRVTgNDFRLFATPIINLFKRRCSPVLINGEHTEYPVIVDPLNPRLYEVHHVLGVNGLLSEGGSVQFSSL 377
gi 16121758 283 WQH----DFSFSEK--NLRLHCVPVINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTG--HQVYVP 354
gi 16123130 303 PQD----LVSHVAP-SRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSRPLDYEVFAINKVFGQQAETSNEVVFNP 377
gi 15799909 291 LPV----DIRLRRD--SLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQHYDVFSVNSVVSQVQDMFRKKDLGR 364
gi 13472142 297 VPE----LADVTVA--DFELFVTPVINLFERECNVIEIDPRKTRQVLHADRTRARDFEIFRVTRVEDADAES-GEATIPE 369
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16763650 379 LYHTRNnDEGNHGR---YFSLRREPRRSSENARRYG-TRTPYTGSEVFLSLVDQH----EAPYPENLRHITVTAMVTNRD 450
gi 15890646 364 FFG-R--TQRNNGA-----NVFWQIQ------RRFD----DDGSSDTDIAFVDEK----RGPLGPLDVVASIDTLCINRE 421
gi 15829483 365 PVSTQAaRQWPAFEsfsHQMEYSRKREVVYWHHRTK-TSLFHRGFDHTLAFIHADgsypSDESLLSNEVVSVSLTCTNRE 443
gi 15595286 371 FYAVR--DPARYGReqaYFRVRREPRVLSSKQRRKG-PRSTYVGSETFVALVDAN----QAPYRHDLRQLGIAALCTNRD 443
gi 15596857 289 GYQAY--VPFESFE---HDPSFDVPEARPHYSVRQR-TSLLHDGLDTYLSFGIRH-----P---EQIETLSVELTCTNQN 354
gi 15597565 364 YYGCR--HDSHLGT--------LYWH-----ARRIAgLTPNRLGSDLLLSLVDTGf---DPLREAPAFSLTAELLCTNRY 425
gi 17548968 373 VTEFRPfYSLHHGE------EPGQAG-HYWIARRNElVAQRSPGFETEISIVDTR----FDPASPQTDTLSLTVTCTNRD 441
gi 15600881 343 RIRGEK-RIYSSFEsfqHEVERVRHRQALYYRTRVK-ESIRGDGFDSFISFVRGD----ETLSMGVDEAVSIKLTCTNRL 416
gi 16120834 378 HGHARFdDDDKMAG-----YSIRRRRDFTDKNHQKN---SPLPHDSLFIALSPGT----SGIDIDHVKSLSIEAMVCERH 445
gi 16121758 355 FTSFR-----HKGG------MLRHDAPEYYYHTRVK--RGPSGLHDTWLVLGGEAf---DNHSVPDNENLSLSLTGTNGQ 418
gi 16123130 378 LYQTRHcDNGNFGR---YFSITRKARTGDSNKRKYD-TRTPYASTEVFVSLVDQQ----EAPYGDSLRYLSIEAQVTNRD 449
gi 15799909 365 PVSTQAaRQWPAFEsfsHQMEYSRKREVVYWHHRTK-TSLFHRGFDHTLAFIHADgsypSDESLLSNEVVSVSLTCTNRE 443
gi 13472142 370 LFSLG--QNRGSGW---VYSTERRPRRATEDERREGlTRTSYTGDDVFIAVSRPAg---SSPN-RPLKRLDITALCTNRD 440
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16763650 451 LPCLIPRn-GRDDLTVDA-AIPVAGVGLIRPPRPPQ--------PPLAE----REMAWRLIRQLSFNYLPLADLDHRTGG 516
gi 15890646 422 LPSQLPFggGHPFLQLSTgNEAVKSVHALMPPTAAI--------RVNER----SAREWRLISHLLLNHLSLTDSGG---- 485
gi 15829483 444 LPSQIRS--GDITGTTGK-NAAVASFRNITRPTQPL--------WPVID----GSLHWSLLSAMNLNYLSLLDTDALKQV 508
gi 15595286 444 LPLFMPIgaHKSDFTLED-SAPVMQVRCLAGPSRPR--------ASRAH----DASAWRLISQLSLNYLSLAERGQ--GA 508
gi 15596857 355 LPQRLRL--GDICVACEG-TPEFLGFRNITPATPSY--------APPLN----RDFLWKLISNMSLNYLSLANVDALKVI 419
gi 15597565 426 LAERLGA--G-TALGFER-PGPVAAARLRNAPSAQS--------QPRLD----GQSRWRLVSQLTLNHLSLVEGPR--AL 487
gi 17548968 442 LPSTLAFgqPDGDLSMEG-NSVARAIMLLRKPTPSM--------RLGGG----RAAQWRLISMLSLNHLSLVQNGL---- 504
gi 15600881 417 LPLELGV--GDICVATDS-SPPFATFKNITVPSQSL--------RPVLD----GSLLWTLISNLSLNYLSLLSKDALSCV 481
gi 16120834 446 LIPSQLQ---HPEFKLEI-ALPVGQIEMLRHPAKPQ---------GVPN----IDQAWRALQLIANNPLRYALPDVTDCS 508
gi 16121758 419 LPRKALQs-TVLDTAVKS-TGAQVRVRNLSAPSLPC--------YPPNR----DRFHWRVLSHLGSSFLWMMDNAE---- 480
gi 16123130 450 LPRLISAs-GNFELTMSD-SAPVHGARFVFQPSAPR--------APFAM----DESAWRLIRQLSFNYLPLSDMSHSNGG 515
gi 15799909 444 LPSQIRS--GDITGTTGK-NAAVASFRNITRPTQPL--------WPVID----GSLHWSLLSAMNLNYLSLLDTDALKQV 508
gi 13472142 441 LPILDDT----PTLTLET-ADPVEAVRLLGALRAPQpaipaslpASAAGesraDNLAWRLVAQLSLNFLSLAQEGR--GV 513
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16763650 517 QALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLVYGRGVSCELTVDEEGFSGIS-PYLFGLVLEHYIARH 595
gi 15890646 486 APLKDILSLYSFRDSPETRQLVEAISKVEAQNSHARIGA----TMVPGTDITVEFDPALIARPA-AFVFAGVLNHFFGLY 560
gi 15829483 509 IANFDRHAIHHPQTARLSQQKLDAIERLETRPVDRLFTG----IPVRGLASTLYLHPEPFVCEGeMYLLGTVLSHFLSLY 584
gi 15595286 509 AALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDENAFRGTG-VFLLGAVFERFLARY 587
gi 15596857 420 LETYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRG----LPLRGLRTELTIDPEGYIGEGdLFVFASVLNEFFALY 495
gi 15597565 488 EALREILALHNLRDDASARRQIEGLRQLDCQRVVAHVGEDAWRGWRNGLEIRLRLDPQHFVGAS-GVLFSAVLAQFFSLY 566
gi 17548968 505 PTLKEMLRLHDLPHSAISARQIEGVVGLDYAPATHWLAGKPFATFVRGLEIRLTLDEDAFVGTG-LHRFIRVLDHFFGLY 583
gi 15600881 482 LRAYDFRALVDRQAERVARMRLDGIVKIESKPVDKILRG----LPVRGLQSTLYVDQAGFGSEGdLFLFGTVLSHFFALY 557
gi 16120834 509 PLLKDWLSIFCQHEEASQHKRITSLTHASVAHNFERHTAPGPIAWSRGVEATLDFNSSHHSDKG-AFLFARILHHALSEY 587
gi 16121758 481 -VLRGTLALYDWTDNEMNRRRLEAIAEVKHSEIERFERG----YLLRGVHIEITLDSNGFTGTGdICLFGEMLSRFFALY 555
gi 16123130 516 ESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVYGRGICCTLTVDEEGFSGIS-PYLFGMIMENYVARH 594
gi 15799909 509 IANFDRHAIHHPQTARLSQQKLDAIERLETRPVDRLFTG----IPVRGLASTLYLHPEPFVCEGeMYLLGTVLSHFLSLY 584
gi 13472142 514 DPLHALLDLYADRGDPSLARNVHSIVRIDSRPVIERLQIDGPMCFGRGTEVTLHVDQSVLAGQS-SLLLSALLSRLFARH 592
                       650       660       670
                ....*....|....*....|....*....|...
gi 16763650 596 VSINTFSQMTLHSMQR-GHVMTWPVRTGQRGSV 627
gi 15890646 561 TSINSFTRLTATMRGHsKPIARWPARAADRPLL 593
gi 15829483 585 ASVNSFHMLTVVNTES-QETWKWTERIGQHPLI 616
gi 15595286 588 VSINSFTETVLRTGER-GEVMRWQAKPGSRPNL 619
gi 15596857 496 ASINSYHELRVRSTQ--GDVYQWKPRMGLQPLL 526
gi 15597565 567 ATANRFVRTVLVEAD--KEVKTWQPQAGSPLSL 597
gi 17548968 584 VHINSFVQLIAVSRRSgKELVRCAPRSGESILV 616
gi 15600881 558 ASINSFHELVVVNISN-QEKYSWGTQSGMQPLI 589
gi 16120834 588 CELGQTLRLHMQVDG--ETFAKWGPVNYG---- 614
gi 16121758 556 TDIHLFNRLTLILQPT-GERLEWEENHQSRLPG 587
gi 16123130 595 AAINVFTETELNSMQR-GRVGHWKARPGRRGVL 626
gi 15799909 585 ASVNSFHMLTVVNTES-QETWKWTERIGQHPLI 616
gi 13472142 593 AGINGFVRTRTRLLQK-QEDVPWPMTPGNRYLI 624
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap