Conserved Protein Domain Family
COG3517

?
COG3517: COG3517 
Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and vesicular transport]
Statistics
?
PSSM-Id: 226048
View PSSM: COG3517
Aligned: 16 rows
Threshold Bit Score: 671.374
Threshold Setting Gi: 15890643
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121741   3 MSVQENRAQGTATTvlKNSPAAQgVYAALFEKINLSPVSSlagiEAFQNNDALAeattdervtaavsVFLDLLKQSAKKV 82
gi 15890642   1 MSAESLLKSEAQAT--TAENQG--LLSKVVSATRQTEPD--------RAQNLLR-------------TLTDQALKGTVKY 55
gi 15595282   1 MAELSTEN-LAQGQ--TTTEQTS-EFASLLLQEFKPKTER----AREAVETAVR-------------TLAEHALEQTSLI 59
gi 15596855   1 MSTSAAQQGRN-------QNGEYnILDSIIAETRLSPDD-----EAY---DIAKrg---------vsAFIEELLKPQNDG 56
gi 15597562   1 -MPKSSAAEQSGES--STQTLS--LLDEIIAKGRMAHDDS----QQDYARDMLA-------------EFATQVLDEGMAV 58
gi 17548965   1 MLDNQSAALAQSAP--AAESVN--LLDEIVEQSRVAKSDA----EHARAKDIIG-------------ELVNQVLQGTVVV 59
gi 16763656   1 MANSNMQATDAVAQ--DTASASG-EFDALLNQAFRPKTTQ----AAKAVEAAVQ-------------TLAQQALANTITV 60
gi 15600879   2 MSTTEKVLERP-------QLAQGsLLDEIMAQTRIAPSE-----EGY---DIAKkg---------vaAFIENLMGSQHSA 57
gi 16120831   1 MENMQKAQLNDTPD--INVDLAEnELDDILKRSFRPRTDE----ASATVRRAIG-------------TLAAYANKGQVKV 61
gi 16123123   1 MSTQDAKTKQATVA--SATEYS--DFNTLLTKEFKAKSEQ----TIAAVEGAVK-------------TLAEQALANSVTV 59
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121741  83 EKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELLDISKDHLVQDFE--DAPEIS 160
gi 15890642  56 DRNLTVTLNHAIAELDRTISEQLAAIMQAPEFAKLEGTWRGLNYLVKNSETSVNLKIRVMNAGKRELARDLE--KAVEFD 133
gi 15595282  60 SNDAIKSIESIIAALDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKkfKGTTWD 139
gi 15596855  57 EPVKKAMVDRMIAEIDAKLSTQMDEILHHPDFQALESAWRGLQLLVDRTNFRENIKIEILSVSKQDLLDDFE--DSPEVM 134
gi 15597562  59 DKDTVAMINDRISQIDALISDQLNQIIHHPELQKLEASWRGLHQLVSNTETSARLKLRLLNVGKNELQNDLE--KAVEFD 136
gi 17548965  60 SDNLSATLDARVAELDRLISSQLSAVMHTPEFQKLEGTWRGLSYLVKETQTSTMLKIKVLNATKRDLVRDFK--TAIDFD 137
gi 16763656  61 SDDAYKSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKryKGIAWD 140
gi 15600879  58 EPVNKSLVDQMLVELDKKISAQMDEILHNSQFQAMESAWRGLKLFVDRTDFRENNKVEILHVTKDELLEDFE--FAPETA 135
gi 16120831  62 NRDVVLTIESLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRVLNISQDELGKTLRryRGSAWD 141
gi 16123123  60 SDDAYKSIASIIAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKryKGVAWD 139
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121741 161 QSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHMPFIGSVGPAFFGKENMEEVAAIKDIGNY 240
gi 15890642 134 QSRLFKAIYEDEFGTPGGEPLGAIIGDYEFGNSFDDVQLLQGVSSIAAAAFAPFISAASPHMFGFEDYRDLARPRDLEKI 213
gi 15595282 140 QSPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKI 219
gi 15596855 135 QSGLYKHIYTAEYGQFGGQPVGAIIANYYMSPSSPDVKLMQYVSSVACMAHAPFVAAAGPKFFGLESFTGLPDLKDLKDH 214
gi 15597562 137 QSALFKKIYEEEYGTFGGHPFSLLIGDFTFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMNSFTELAVPRDLTKI 216
gi 17548965 138 QSALFKKVYEEEFGTFGGAPFGTLIGDFEVTRQPEDVYFIEQMSHVAAAAHAPFIASSSPELFGLESFADLGKPRDLAKV 217
gi 16763656 141 QSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLTKI 220
gi 15600879 136 QSGLYKHVYSAGYGQFGGEPVGAIIGNYAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIKDLKST 215
gi 16120831 142 QSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWRELGNPRDIGKI 221
gi 16123123 140 QSPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQELSNPRDLTKI 219
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121741 241 FDR-AEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGP-DTVPVRSFNYVEQVKG----PDHERYLWTNASFAFAANMVKS 314
gi 15890642 214 FDT-VEYAKWRSFRESDDSRFVTLALPRVLARMPYGP-KTNPVDDFAYDETRGAvngdLQHDEYCWMNAAYVMGTKLTEA 291
gi 15595282 220 FTT-PEYAGWRSLRESEDSRYIGLTMPRFLARLPYGA-KTDPVEEFAFEEETDg----aDSSKYAWANSAYAMAVNINRS 293
gi 15596855 215 FEG-PQFAKWQSFRQSEDSRYVALTVPRFLLRTPYDP-EENPVKSFAYKETVA-----NSHEHYLWGNTAYAFGTKLTDS 287
gi 15597562 217 FES-LELIKWRAFRESEDSRYVSLVLPNFLLRLPYGP-ETRPVEGMNYVEDvn----gTDHSKYLWGNAAWVLAQRITEA 290
gi 17548965 218 FDT-VEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPkDGTTVEGFNFVEDvd----gTDHSKYLWCNAAWAFGARLTAA 292
gi 16763656 221 VTQnLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGA-KTNPVDEFDFEEDADg----sDHTKYVWSNAAYAMGVNINRS 295
gi 15600879 216 FES-PKYTKWRSLRESEDARYLGLTAPRFLLRVPYDP-IENPVKSFNYAENVS-----ASHEHYLWGNTAFAFATRLTDS 288
gi 16120831 222 FTT-PEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGA-KNHPIDDFAFEEVVSp----hASEDFTWANAAYAMGVNINRA 295
gi 16123123 220 FTQnLEYAAWNSLRQSEDSRYIGLAMPRFLSRLPYGI-NTNPVDAFHFEETTDg----aDHSKYVWSNAAYAMAVNINRS 294
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121741 315 FIKNGWCVQIRGPQAGGAVTNLPIHLYDL-GTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKP 393
gi 15890642 292 FAKSGWCTAIRGAENGGRVENLPMHVFSSdDGDLDLKCPTEVGITDRRDAELGKLGFLPLCHYKNTDYAVFFGAQTAHKP 371
gi 15595282 294 FKLYGWCSRIRGVESGGEVQGLPAHTFPTdDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTDFAAFIGAQSLQKP 373
gi 15596855 288 FAKYRWCPNIIGPQSGGAVEDLPLHHFES-MGEIETKIPTEVLVSDRREYELAEEGFISLTMRKGSDNAAFFSASSVQKP 366
gi 15597562 291 FAKYGWCAAIRGAEGGGAVEGLPAHTFRTsSGDLSLKCPTEVAITDRREKELNDLGFISLCHKKNSDVAVFFGGQTTNKA 370
gi 17548965 293 FEDFGWCAAIRGVEGGGLVEDLPTHTFKTdDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKNSDYAAFFAAQSVQRP 372
gi 16763656 296 FKHYGWCTLIRGVESGGAVENLPCHTFPTdDGGVDMKCPTEIAISDRREAELAKNGFIPLIHRKNSDYAAFIGAQSLQKP 375
gi 15600879 289 FAKYRWCPNIIGPQSGGAVEDLPVHVFES-MGALQSKIPTEVLITDRKEFELAEEGFIALTMRKGSDNAAFFSANSIQKP 367
gi 16120831 296 FNEYGWCSRIRGIESGGSVEELPAYAFPSdEGGYELTCPTELAISDRRENELSNAGFLPLVYRKNSDFAAFIGSCTLHAP 375
gi 16123123 295 FKEYGWCTLIRGVESGGVVEGLPCHTFPTdDGGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNTDYAAFIGAQSLQKP 374
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121741 394 ALYD----TADATANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELELNNWVRGLVTEM-TDPGDDLQASHP 468
gi 15890642 372 KLYD----KPEATANAAVSARLPYIMATSRFAHYLKVMGRDKIGSFMEASDCEVWLNRWIANYVNAN-DEAGEESRAKYP 446
gi 15595282 374 AEYD----DPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDpAHSTETTKAQHP 449
gi 15596855 367 KFFGisaeGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLELELNKWIRQYVADQ-ENPSAEVRGRRP 445
gi 15597562 371 RLYN----TNEANANARLSAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQTYLNNWIADYVLIN-DNAPQEIKAQYP 445
gi 17548965 373 KKYD----TDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAKNVETFLNRWISQYVLLD-DNATQEQKAQFP 447
gi 16763656 376 QEYY----DPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKEREDMQRWLNEWIMNYVDADpVNSSQETKARRP 451
gi 15600879 368 KVFPntkeGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLERELNSWIKQYVADQ-ENPPADVRSRRP 446
gi 16120831 376 ANYD----DPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSRDDMQLWLNDWVMNYVDGDpSISTEATKAKRP 451
gi 16123123 375 AEYY----DSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDEMQRWLNDWVMNYVDGDpANSSLETKARRP 450
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*...
gi 16121741 469 LRDAKVTVEDIEDNPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA 516
gi 15890642 447 LRDAKVTVQEVPGKPGAYNAVAWMRPWLQMEELTTSLRMVARIPSKN- 493
gi 15595282 450 LAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKE 497
gi 15596855 446 LRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDKE-- 491
gi 15597562 446 LREARVDVSEVAGKPGAYRATVFLRPHFQLEELSASIRLVANLPPPVA 493
gi 17548965 448 LREASIQVSEVPGKPGTYRSVAFLRPHFQLDELSISLRLVADLPKPTN 495
gi 16763656 452 LAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLPSVKQ 499
gi 15600879 447 LRAARIEVMDVEGNPGWYQVSLSVRPHFKYMGANFELSLVGRLDQA-- 492
gi 16120831 452 LAAAEVQVEDVEDDPGFYRAHFYLRPHYQLEGMTVSLRLVSKLPSNKE 499
gi 16123123 451 LAAAEVIVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRMVAKLPSLKD 498
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap