Conserved Protein Domain Family
COG3515

?
COG3515: COG3515 
Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and vesicular transport]
Statistics
?
PSSM-Id: 226046
View PSSM: COG3515
Aligned: 22 rows
Threshold Bit Score: 106.395
Threshold Setting Gi: 16123747
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121755  14 EPEPLLQQARQQVALWERWLQPVTPDKHTGEDPGYDDHFQQMREEVNKLSgADTTLTCELAEKLFTTHGKDVRVATYYVW 93
gi 15829471   1 -----------MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPE-LNWKLVESLALAIFKANGVDLHTATYYTL 68
gi 15829475   1 ---------------------------------------------------------------------------MAMDL 5
gi 15600890 183 AEQRQQVTAQSSAERETPSAATPSPAASMVVDHSSDKAAKQTLLKVADFL-AEQEFGIALSIRLRRFAVWGSITSLPDHK 261
gi 15600892   1 -----MMSNVIFIDNVCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGG-TDWAVVKEYCEQLACNQGMDFLICGYYAV 74
gi 16121762   1 ------------MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPD-VDWVRVEQLCLALFRQNGVELQTAVDFTL 67
gi 16123744 185 VIEAVASDEPLSSNTLAAAMAATPVSPSLAIDNTSDRAWRQTLLKMADLL-SEQQPDAAIGFRLRRHAVWGALTAPPMAQ 263
gi 16123746   1 -----------MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPE-VNWGLIESLALTLFRTHGVDLQTAVYYTL 68
gi 15799898  20 VCQTHCTEEAGMNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPE-LNWKLVESLALAIFKANGVDLHTATYYTL 98
gi 15799900   1 ------------------MTQPSAPAPQIAIDSHDDKAWRDTLLKVAAIL-CERQPDSPQGYRLRRHALWQSITSTPQAE 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121755  94 ARLHRDGEAGLADGLSLLAGLITRFGEGLHPLRTTSRKTALEWLAGsrMrdslslYPEVDKADFERIVgaLALIEQRLSL 173
gi 15829471  69 ARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFN-----------SRTGNILRQQIS--FAESDLPLIY 135
gi 15829475   6 RDPNVWISHLLENLPEEKLASALKDDNPDWEYIDGEIVKLGSLAHAqlD------IPELQRRGLQLLA--SESKDFRLLA 77
gi 15600890 262 PDGETLLRGMQADRVKDYQDQLRHPDLALWRKVEQSLTMAPYWFEGqwM------SYTIAQQLGKSDW--CQAIAEETQQ 333
gi 15600892  75 ACLKTQGLAGYATGMELMSASLANQGECDVKS-AKVRKEILDWVN------------ARVVQELKALK--PTYESLRDLY 139
gi 16121762  68 ARTHTVGLAGLCEGLELLAGLVCHQWRGLWPPQTHARVALLAWLS------------DRLQQVWRTMT--LCYGDLAQVY 133
gi 16123744 264 SDGRTPLAAVSADRTADYLARLANADLPLWHQVEQSLTLAPYWLDGhvL------SAQIALQLGYDAV--AQAIRDELSV 335
gi 16123746  69 ARTQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFN-----------TRVSNQLRQHD---FTRDDLRLVY 134
gi 15799898  99 ARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFN-----------SRTGNILRQQIS--FAESDLPLIY 165
gi 15799900  62 SDGRTPLAAVSADMVADYQSRLASADMALWQQVEKSVLLAPYWLDGhcL------SAQTALRLGYKQV--ADTIRDEVIR 133
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121755 174 WDEGVRPQLGGLYTALENRLAqsgglnavvpqnssgsSSAGSLNPANTASPALRPVQSGRDLLDqtktlaKYLRNQPQGW 253
gi 15829471 136 RTERALQLICDKLQQVELKRV----------------PRVENLLYFMQNTRKRLEPQLKSNTEN------AAQTTVRTLI 193
gi 15829475  78 HLLRTLQHAGDPLLALHLLTL----------------YVEHYWTVAAPQNMAHKKRFASQIIK-------RFETVLKAFH 134
gi 15600890 334 FLRRLPSLLELKFKGGEPFVS----------------DSVKEWLASVGQSQGAAGQSVGGDWQEkr--keAFQLAKEGGI 395
gi 15600892 140 RAERHCERLHQLFEQQQTEYK----------------VDFEGVGFALFEHIDRIETQYHSLLKKq----eKAQPPKLKFW 199
gi 16121762 134 RAERALEQLCTQLQTLELKHL----------------CKLDGVRLMLHNAAQRLESTEAVSGLAkprgasEPPESLRFAS 197
gi 16123744 336 FLARIPALKTLFFTDMTPFLS----------------SESAAWLQQDANHQGRSRTIEQDE---------IWQCYQQQGL 390
gi 16123746 135 RAERALQLLYDKLQQVELKRV----------------PRIENLLYLMQNTAKKLESASDA---A------KAQQTAAPLK 189
gi 15799898 166 RTERALQLICDKLQQVELKRV----------------PRVENLLYFMQNTRKRLEPQLKSNTEN------AAQTTVRTLI 223
gi 15799900 134 FLERLPQLTGLLFNDRTPFLS----------------EQTKQWLAASPDGKVAPVAQIGEESQA------ARACFAGQGL 191
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121755 254 LSGHHLIKSvrwdtvhqsPPLDVNGRTRLVPprpeYRVQLKRLYLQQNWLALLEQAESIFAEGVNHfwldvqwylhqals 333
gi 15829471 194 YAPETQASS---------TPEAVVPPLPGLPemkvEVRSLTENPPQASVIKQGSTVRGFIAGIACSv------------- 251
gi 15829475 135 KTLPQRSAI---------LCWVSWRNWRSAG-----SHITSRNWHRLPMIFLPCTSVRLIVRLLLR-------------- 186
gi 15600890 396 AVALSMLNDg--------LVSAVEPRDKFYW-----RLLSADLLRANHLDAMAGEQYQTLLNQVTT-------------- 448
gi 15600892 200 QRGYALFTLg--------VLGVALGMVGGYWgwpwFYTTPYAAPQRITTLNEASQTQALLNDSSTSera----------r 261
gi 16121762 198 VPVSEPLVYi--------ISEPAPPPVQVVLpaspPRWKAGHGFAAGLSLMAVLMAGSFVIWQSVSsdpv--------re 261
gi 16123744 391 EAALQMINR---------QPQQSEPRDRFYH-----QLLSAQLFEKAGLTALAQQHYHSLLLVGQQ-------------- 442
gi 16123746 190 MPPMVYLS----------VPEA-EP-----------VRTAAAAPEPAANIEVRSPPRRLNGGRCCGal-----------v 236
gi 15799898 224 YAPETQASS---------TPEAVVPPLPGLPemkvEVRSLTENPPQASVIKQGSTVRGFIAGIACSv------------- 281
gi 15799900 192 EAALRYLDM---------LPE-GDPRDQFHR-----QYLAAQLTEEAGLIQLAQQQYRMLLMIGSQ-------------- 242
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16121755 334 kAGAPFDGWASCITQDLRLLLTRLPGLEGLCWSDgtpFADEVTLGWINQQVLESVSGWGSEPAAVSSGEDGILLLEPEAL 413
gi 15829471 252 aVASALWWWQVYPVQQQLLQVNDTAQGAATVWMA---SPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQ 328
gi 15829475 187 --SPLRRPPVVHHKPPSRLKAA---------------------------------------------------------- 206
gi 15600890 449 --LSVPEWEPSLVEQIQRYTTSE--------------------------------------------------------- 469
gi 15600892 262 wQHDLIPLYRDTLQQNLTISFSEPKRHAITQLNL---LRTLYPENEQVNALSQEFALQQQQALEQTALFVAKFS--EIRT 336
gi 16121762 262 tLLATASPLPIPLSANSIAELKKQASDVEWARLA---EPVLQASAMQLDQLTQLPPLWAQARGDALLSQAQQLWPTNQEV 338
gi 16123744 443 --LQLSEWEPALIALLTEKQRQLKP------------------------------------------------------- 465
gi 16123746 237 pVSCVVYWWRLRFTLPSSNRCNSK-------------------------------------------------------- 260
gi 15799898 282 aVASALWWWQVYPVQQQLLQVNDTAQGAATVWMA---SPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQ 358
gi 15799900 243 --MMVSDWEPSLLTQLEQKFTAEQ-------------------------------------------------------- 264

                ....*....
gi 16121755 414 AQADSEGIE 422
gi 15829471 329 QQASTQWNE 337
gi 15829475     ---------
gi 15600890     ---------
gi 15600892 337 KMANISLLA 345
gi 16121762 339 KRLNALWQQ 347
gi 16123744     ---------
gi 16123746     ---------
gi 15799898 359 QQASTQWNE 367
gi 15799900     ---------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap