Conserved Protein Domain Family
VgrG

?
COG3501: VgrG 
Uncharacterized conserved protein, implicated in type VI secretion and phage assembly [Intracellular trafficking, secretion, and vesicular transport, Mobilome: prophages, transposons, General function prediction only]
Statistics
?
PSSM-Id: 226032
View PSSM: COG3501
Aligned: 45 rows
Threshold Bit Score: 143.239
Threshold Setting Gi: 17230812
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548147  80 GARALLTQDFRYITIETPLG--ADVLLVSALVADEHVNQ----------LPEIHLDLLSHRN---------DIGFEEIVG 138
gi 15595289   1 ------MQLTRLVQVDCPLG--PDVLLLQRMEGREELGR----------LFAYELHLVSENP---------NLPLEQLLG 53
gi 15595293   1 ---MALAQQTRLVRVDSPLG--AEVLQLQRMEGREELGR----------PFAYELELISENP---------DLPLDGLLG 56
gi 15597569   1 -----MPRPTDTNTTLSLSAstLGDLYPQTLSGGEALNE------------LGSLTLGGYSAt--------ALTLSNAVA 55
gi 15597881  35 RFPMLFSQHTRLVHVDSPLG--PEVLQLQRLEGREELGR----------LFSHELELVSSNP---------ALPLDALLG 93
gi 15600283   1 ----MFAPANQTHFSLRIENlrHD-FQVLAFRGREAISQ----------PFRFDLELVSERS---------DLDLDALLH 56
gi 15600459   1 ----MFAAANQTHFSLAIDGlaLD-LQVLSFSGREAISQ----------PFAFDLELVGERP---------VPDLESLLH 56
gi 16763672  87 IVSAVAGGPGAHNVTVSGSAvpPGALLFASLDGGETLSElfsyvvqlktPDTLNLGYVSPAA---------NLPLKPMVG 157
gi 16122929   1 -----MSRTINLSSPAMPYLlgEPALVLSKLEGEEAFST----------LYSYTITAKTPANplipwqaasNVDLKSLIG 65
gi 13472156   1 ------MPNERATVVHTPVG--ADVLTFTHLVGRDEISR----------SFAYTVGFVSKSR---------DVDPLKMLG 53
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548147 139 QRVKIMLDPRSRNtslasivagadpgseRRYFDGYVASFGRVGNPGAVTRYEMTVVPWFWFLTRSTDCRIFQNQSAQDIL 218
gi 15595289  54 KPMSLSLELPGGS---------------RRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEII 118
gi 15595293  57 KPASLALELHDGS---------------RRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDII 121
gi 15597569  56 THLTATLHNDAD----------------QRPLDGLVAEIRQLPGDASAERYQVLLRPWLWWLTLASNNRVFQNLATSDIV 119
gi 15597881  94 KPMSLALELPGGS---------------RRYFHGIVARCSQGAGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDII 158
gi 15600283  57 QPAFLILSPSG-----------------Q-GVHGQLTSIAQGDSGKRLTGYRATLEPRLAYLGLCSDQRIFQRLSVPEII 118
gi 15600459  57 KPAFLTLGPAG-----------------N-GIHGLVRSAGQGDSGKRLTRYRITLVPQLAYLAQRTNQRIFQHLTVPQIV 118
gi 16763672 158 KDLCVNIELDGGG---------------KRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLTHTSDYKAFQNKTVVDIL 222
gi 16122929  66 KEMTIEMELDGNGlgdvr-----svgkgTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDII 140
gi 13472156  54 G--VVSVEGESDP---------------KRWFSGLVSDFKLTRIEDRLAYYEATVRPWLWFLGNTTDCRIFQNMTAVEIV 116
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548147 219 GSIFQELGFSDFEFH-LWG--NHPTLEYVVMYDESYYNFCARLMEQEGLIWTVRYEQDKHVLVIGDANT-MFRQIPSlaa 294
gi 15595289 119 KQVFRNLGFSDFEDA-LTR--PYREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLSDAYG-AHRSPGGyas 194
gi 15595293 122 KQVFRDLGFSDFEDA-LSR--SYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHILVLSDAYG-AHQSPPNyas 197
gi 15597569 120 TQVFDQHGFSDYQLQlSGS---YQPREYCVQYGESDLAFVSRLLEEDGIFWFFTHAAGKHTLVLADSNDaFPPIPNGp-- 194
gi 15597881 159 KQVFRDLGFSDFEDA-LSR--SYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYG-AHHSPAGyts 234
gi 15600283 119 GRVLEGHGILADAYRfQLGptPYPAREYCTQYDETDLAFLSRLCEEEGIHYHHEFSAQGHVLVFGDDQTsFPRLQRp--- 195
gi 15600459 119 GRVLEEHGILADAYRfQLGt-RYPEREYCVQYDESDLQFVQRLCCEEGIHFHFQHSATAHLLVFGDDQTvFPRLAp---- 193
gi 16763672 223 DEVLA-EYPYPVEKRlVES---YPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVLADAISaHKACPDSp-- 296
gi 16122929 141 EEVFS-DYNFPFEKRlATT---YPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGaHKRSFSTayh 216
gi 13472156 117 EKIFSKYGIAKFEKR-LQG--SYPSREYCVQYDESDLDFVQRLFEHEGIFYFFEHDEDKHTLVLCDAMS-KLKPAPGyek 192
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548147 295 vPYYADSAA--SEMNGIARWDEAFQFRVGKITFRDFNYNQPSSRLMHVEEptTLQHANIGATERYQYHSLYDRGEDGRRY 372
gi 15595289 195 vPYYPPTLGh-RERDHFFDWQMAREVQPGSLTLNDYDFQRPGARLEVRSN--IARPHAAADYPLYDYPGEYVQSQDGEQY 271
gi 15595293 198 vPYYPPTLEq-RERDHFYDWHMAREVQSGSLSLNDYDFQRPGARLEVRSN--IARSHAAADYPLYDYPGEYVQSQDGEQY 274
gi 15597569 195 qVAYLGQGIgvRELQGVRSAQYSLQAVSGTYSATDYEFTTPGTSLYS------QAEAVSGAAGVYQHPGGYTAKAQGDSL 268
gi 15597881 235 vPYYPPSLGh-RERDHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSN--VGRAHAAADYPLYDYPGEYVQSQDGEHY 311
gi 15600283 196 -VAYVQDAGlvADQPVVKRFGVRFDTRASRVTRRDYDFEQPALQMQAAHG--PQPGAQQPDLEDYDYPGRFTHRERGKHL 272
gi 15600459 194 -VAYQQDSGlvADRPAVKRFGVRLETRTSHVTRRDYDFEKPRLTLES-----AARGEARPDLEDYDYPGRFVDRERGKHL 267
gi 16763672 297 -LVEWHQEGlkLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVA--NPRETGHATYEHYEWPGDYFDKSEGEML 373
gi 16122929 217 aIEYLSDEPk-AGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDS--KPRKTSFNDLEIYHWPGDYDQPDIGEHL 293
gi 13472156 193 vLYNFEGYGsrRDVEYITEWIPGSAVRPGAYAHTDYDFEKPGADLMAKSA--QSFSHKEASGENYRQPGAHLDVGRGDTI 270
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548147 373 ARYAMEAEEAQARRFNGAAFAQAMTTSARFTLVNHPASRYNGKEFIILGVRHEAVNDYTR-----------QAAETPYRN 441
gi 15595289 272 ARNRIEAIQAQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETg---------sGGAGSQFES 342
gi 15595293 275 ARTRIEALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETg---------gGGVGAQFES 345
gi 15597569 269 TKQRIDGLRSQETRLIGESDCRWLVPGHWFTLSGHDDDSLNIDWVLTSVTHDAS--------------------HAHYRN 328
gi 15597881 312 ARTRIEAIQTQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGAEYRVVQELYETg---------nGGGGAQFES 382
gi 15600283 273 SHRALERHRADYLQARGESDEPALLSGHFLTLSAHPRGEWNDLWLLTEVLHEGRQPQVLEesidsdvaqgqGDFRQGYRN 352
gi 15600459 268 ARRALERQRSDYHLAEGRSDQPLLLSGHFLPLAAHPQAGWNDLWLLTEVIHEGRQPQVLEesivsdasaspDDFRQGYRN 347
gi 16763672 374 TRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLMQTLLFVQDNAQHSg----------qDQHFTFST 443
gi 16122929 294 SRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSg----------GEDAFSCES 363
gi 13472156 271 AGIRREELQAVHQRNTAVGTVRGLFSGCKFTLESFPRDDQNAEYLVVSAEYRLFDPGYRTq---------nEAHSENFKV 341
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548147 442 TFTCLPFDIPFRPARRTPKPYMHGTQPAIVVGPKGEEIYTDGS-RVKLHFLWDRRGRLDGSDSMWVRVSQPWAGKGWGGS 520
gi 15595289 343 ELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYgRVKVHFHWDRHDQSNENSSCWIRVSQAWAGKNWGSM 422
gi 15595293 346 ELDCIDAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYgRVKVHFHWDRHDQSNENSSCWIRVSQAWAGKNWGSM 425
gi 15597569 329 RFEAIPKATAYRPARVTPKPRMH-TQTALVVGKAGEEIWTDQYgRIKIQFPWDRDGKNDETSSCWVRVVLPWSGKGFGMQ 407
gi 15597881 383 ELDCIDAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEIWTDQYgRVKVHFHWDRHDQSNENSSCWMRVSQAWAGKNWGSI 462
gi 15600283 353 HFVATPWSAHFRPPLEHPRPRVLGCQTAVVTGPAGETIHCDQYgRVKVQFFWDRLGQADDNTSCWLRVASNWGGKRYGGV 432
gi 15600459 348 RFQATPWEAFFRPPSTPPKPRILGTQSAVVTGPKGEEIHCDRYgRVKVQFHWDREGQADDSSSCWLRVASGWAGRNYGAI 427
gi 16763672 444 RFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYgRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMI 523
gi 16122929 364 SFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYgRVKVRFVWDRYGTNSESDSCWLRVSQAWAGNSFGGI 443
gi 13472156 342 VLGVAPTKLPYRPPRITPRPIMRGPQTATVVGPSGEEIFTDKYaRVKVQFHWDRLGKKDQNSSCFVRVSQTWAGSGWGFI 421
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548147 521 AIPRIGQEVVVAFNQGDPDNPIVVGRVFNGESGNPYHG-SSGQTMGIRSQTHKGT---GFNELRFSDVNGAEEVFVHAQK 596
gi 15595289 423 QIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELpANATQSGMKSRSSKGGtpaNFNEIRMEDKKGAEQLYIHAER 502
gi 15595293 426 QIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELpANATQSGMKSRSSKGGtpaNFNEIRMEDKKGAEQLFIHAEK 505
gi 15597569 408 FVPRIGQEVIVTFIDGDPDRPLVTGCVYNGDNALPYALpDNQTQSGIKTNSSKGGg--GFNELRFEDKKDAEEVFLQAQK 485
gi 15597881 463 QIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELpANATQSGTKSRSSKGGtpaNFNEIRMEDKKGAEQLFIHAER 542
gi 15600283 433 AIPRVGMEVLVGFLEGDPDQPLVTGCLYHSENRVPYELpQNKTRSVFKTDSYPGGg--GFNELRIEDRKGQEQIFVHAQR 510
gi 15600459 428 AIPRVGMEVLVTFLEGDPDQPLVTGCLFHREHPVPYELpGHKTRSVFKSLSSPGGg--GYNELRIEDRKGQEQIFVHAQR 505
gi 16763672 524 QIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGLpGMASQSGIFSHSLYGGp-tNGNMLRFDDKTGAEEVKFHAEK 602
gi 16122929 444 YIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLpANATQSGMVSRTVGGGl-tNYNGVRFEDKSGLEQYWEQAER 522
gi 13472156 422 QIPRIGQEVIVDFIEGDPDLPIITGRVYNASEMPPYALpGNATQSGWKSNSSKGGg--GYNELMFEDKAGSELVNFQAQK 499
                       570       580       590       600       610       620       630
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17548147 597 DMNTVIKDNETRSIEAGNRAITVH--------KGDEVKRVaq-------------gNlTETI-AKARGTT 644
gi 15595289 503 NQDNLVENDASLSVGHDRNKSIGH--------DELARIGN----------------NrTRAV-KLNDTLL 547
gi 15595293 506 NQDIEVENDETHWVGHDRTKTIDH--------DETVHVKH----------------DrTETV-DNNETIT 550
gi 15597569 486 DLNVNVLNDSTASIGHDETLTVQN--------ARTRTVKEg---------------DeTVTLeKGKRTVT 532
gi 15597881 543 NQDIEVENDESHWVGHDRTKTIDH--------DETVHVKH----------------DrTETV-DNNETIT 587
gi 15600283 511 DWDENIEHDQKIRVGHERHDTVEGdsysefraEEQRTVHA----------------DrKVEL-KAADHLS 563
gi 15600459 506 DWDENIEHDQKIRVGHQRHDTVQAnsysefkaEEHRTTHA----------------ErKVEV-RASDHLT 558
gi 16763672 603 DLNTTVKNNETHTVMVDRTKTIIK--------NETNSIGE----------------DrNTTV-TKNDGLS 647
gi 16122929 523 DMSRLTKNNETQIIGADSVLNVGAnrsevvgaNYNQDVLGtsmlaigaasmlqvglArSVVVgGAHSLNV 592
gi 13472156 500 DHHLLIKHDRNKTVQHDQSDRIDH--------DAKHSVGHnldedvgnnktvkigvDqTTNI-GSNDTET 560
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap