Conserved Protein Domain Family
COG3455

?
COG3455: COG3455 
Type VI protein secretion system component VasF [Intracellular trafficking, secretion, and vesicular transport]
Statistics
?
PSSM-Id: 225986
View PSSM: COG3455
Aligned: 16 rows
Threshold Bit Score: 139.033
Threshold Setting Gi: 16122927
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13472158  46 PGLGRQMPPgwsSETMVFQEAGHGAESAAAPALQQDALLNatagv-------kyaaANPILAAAAPLLMLFGQLRLIPVE 118
gi 15890650  28 RRRNQNARNmaaILEDIVETDEQARPARGKVATLPVDKLLtgfhf-------ggeeVPTLVQSAAPLLNLAHLLRFSDAE 100
gi 15595276  28 PRPGGRAPE---PAGGPRGGDPYTPPPMASLAPLSGRGDG----------------LNPLEQAAGPLLAMLTRLRNTIAH 88
gi 15596865  17 DHQGQVPAQgplTDFAEPPRFEQLEERMIYAARLRP-GEAfn------------vsLNPLVAAASELLSEVVRLKHSTVL 83
gi 15597558   1 ---------------MPEGSAGPFSQAYQEQPLSTAFRQA----------------WQEWLEAWGALDRDAQDVPRMVER 49
gi 16763665  19 TTPEHKDSEyetPVHTSQRTELNVIVEDGPDSKLRLAEISa--------------aANPLLAAARPLLCALAAMPAKLDA 84
gi 22127533  94 QQPNANDSYpngNNNNPNGDNNNPNGSNNNIARVQRMPHGisrglyerpgmllgawDNAYIAAAMPLLLLVENIRSWPTR 173
gi 16121279   1 -----------------------MNPHLTEHPPV---GDI----------------DALLQD--TWLQVISLRQGVTCAE 36
gi 16121743   1 -----------------------MNPHLTEHPPV---GDI----------------DALLQD--TWLQVISLRQGVTCAE 36
gi 16122927     --------------------------------------------------------------------------------
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13472158 119 RQAAALAEHIADAIETFDHTIAKAGIGEEDARIAKFALCETTDDLVGNLPWPNKE--TWLQHSLVVQFFHTRPTGTGFYE 196
gi 15890650 101 PDPDQLRRACVEAITRYERDLASARISPERARAAHYVVCATVDDVVLSKPWGVRA--GWARSGLVSTFHNDVTGGDRVFD 178
gi 15595276  89 PAPASLRAQLLGYLRQFEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWGSTS--DWGKQSLLITLHNEAWGGEKVFQ 166
gi 15596865  84 ENLAALKERLTSAMKLFEFRAVQDGVENSQVMAARYVLCTVVDEAVVTTPWGNES--EWSKISLLSSFHNETFGGEKFFQ 161
gi 15597558  50 ALELSTRITRRLWRSAFASVGDAAGVQ---VKAMVYAFVALVDETLVFSAWPGQG--AWQDKPLESHLYGSRQAGEYLPL 124
gi 16763665  85 ALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRYCLCTALDEAANNTTWGRRG--VWAGKSLLVTFHGESEGGIKLFQ 162
gi 22127533 174 -NAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSY---N--QSLLVEFHRDAWGGEDCFE 247
gi 16121279  37 GEGQAFWQRCVADIERVHQALKDAGHSEQSCQHIRYAQCALLDETVKGRGVQDDAyfVWCHSPLQAHFFNTLDAGSQLYE 116
gi 16121743  37 GEGQAFWQRCVADIERVHQALKDAGHSEQSCQHIRYAQCALLDETVKGRGVQDDAyfVWCHSPLQAHFFNTLDAGSQLYE 116
gi 16122927     --------------------------------------------------------------------------------
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13472158 197 ALNNILAKPEAH-YDLLELMHACLSLGFEGQYRELSGERNTLERVRRDVYDTLRYFRPRAAEDISPRWQGMAAA--MARP 273
gi 15890650 179 ILDHFHQSPGAN-KDLLLLIYLCLSLAFEGRTRVSSKGALELSRIRDSLYKTLIGQYGTFERELSPHWKGVDAR--HTPL 255
gi 15595276 167 LLEHCLQNPHQR-LHLLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTRGEYEHELSPHWRGLSVM--RDRL 243
gi 15596865 162 LLDRLSKNPVKH-LPMLELMYLCLALGFEGKYRVMARGVLDLDGISDALYRQIRQLRGDVPRELSPHWQGLSDQ--RRGL 238
gi 15597558 125 AIKRLLDERAPAsRDLANVYLQCLILGFRGRLR-GPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPprRLPV 203
gi 16763665 163 IIGRLAASFQEH-GNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQLLTQLSQRRDPVMPALSPDFQGAISG--RLRR 239
gi 22127533 248 HLRVYMNSPKQY-REVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRR--QYIK 324
gi 16121279 117 RMRAVLREPAPD-RAVLTCFHRVLMLGFLGGY--ASPAASEREQLIDQLSVQVPAFS-VAPSRGILASAASRN---RLGI 189
gi 16121743 117 RMRAVLREPAPD-RAVLTCFHRVLMLGFLGGY--ASPAASEREQLIDQLSVQVPAFS-VAPSRGILASAASRN---RLGI 189
gi 16122927   1 -----------Y-ADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALSPHGLIAHQN--RRRR 66
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 13472158 274 GGRLPLWAIAAAAAALVTVAFFGLRILITDEGDATAGALLALNPSA 319
gi 15890650 256 RTMTALWTLLSLMALAFALGYLFFTLSLNNASDVTFERLahlppte 301
gi 15595276 244 SQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKRIHAIGEIP 289
gi 15596865 239 VRIVPWWMVALFTLVCLVVMYSGFAWVLGEQRDTVLQPYQSLDAAA 284
gi 15597558 204 RAALPDGFRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAE 249
gi 16763665 240 MRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDAIGIKL 285
gi 22127533 325 ALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKIN 370
gi 16121279 190 WLRY--WPVRLG-LAALMVALLWWG--LDHWLSGLLATLLPEPV-- 228
gi 16121743 190 WLRY--WPVRLG-LAALMVALLWWG--LDHWLSGLLATLLPEPV-- 228
gi 16122927  67 GIFVPVRVSMLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVV 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap