Conserved Protein Domain Family
MVD1

?
COG3407: MVD1 
Mevalonate pyrophosphate decarboxylase [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 225941
View PSSM: COG3407
Aligned: 17 rows
Threshold Bit Score: 307.73
Threshold Setting Gi: 16082295
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16081942  45 MMKSegyysepskyeaelsdgnITFAYSYPIKAFEKFLGYYDRENRIAFNPSISMRT-DFSFCLAACRYRKNGKTDTVVL 123 Thermoplasma acidop...
15595031   1 ---------------------mKIKCKVHASLALIKYWGKKDVFLNIPATSSLAVSVdKFYSISEL----ELSNRDEIIL 55  Lyme disease spiroc...
15926269   1 MIKS-------------------GKARAHTNIALIKYWGKKDEALIIPMNNSISVTLeKFYTETKV-TFNDQLTQDQFWL 60  Staphylococcus aure...
15900305   1 MDRE------------------PVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLeNMYTETTLSPLPANVTADEFYI 62  Streptococcus pneum...
15674902   1 MDPN------------------VITVTSYANIAIIKYWGKENQAKMIPSTSSISLTLeNMFTTTSVSFLPDTATSDQFYI 62  Streptococcus pyoge...
13541151   1 MSNS------------------SITSVAYPTIGVVLLGGIANEKTRTPLHTSAGIAYtDSCGSIRTESTIYGDSEMHIYF 62  Thermoplasma volcanium
13541257  16 MLEDhgylsenndyepnpidgnISISYAYPIKAFEKFLGYYDVENRVAYNPSISMRT-DFSYCIAACRYNKNGNEDTVIL 94  Thermoplasma volcanium
13541613   9 LLKEkglyrapgkyrkemrygeIHYGSGYPITGLIKFLGYYDESLKIANFPSISLNT-DVSEAYSAFMISKDNGNDTAVV 87  Thermoplasma volcanium
16081580  33 LLRDrgiyrrpgmhairpayrkIAFGAGYSEIGIIKSLGYYDSTFNILNFPCVSMAA-DFSRAYAALVLTENIGEDTFIL 111 Thermoplasma acidop...
15789800   1 MRATpph------------rrmKATARAHPIQGLVKYHGMRDESLRMPYHDSISVCT-APSNTTTTVEFDPDRDADQYVV 67  Halobacterium sp. N...
16081942 124 DGYADNKY-YKKAKFALDKFRS-EYSIngSFDFYIKRYRRYQKAKGLSESSAVAAAVSRALISnvfGDDAAKDDIFVSRY 201 Thermoplasma acidop...
15595031  56 NSKPVILK--NREKVFFDYARKiLNEP--NVRFKIKSKNNFPTAAGLASSSSGFASIAACILK----YFNKYSCNSASNL 127 Lyme disease spiroc...
15926269  61 NGEKVSGKeLEKISKYMDIVRN-RAGI--DWYAEIESDNFVPTAAGLASSASAYAALAAACNQ---ALDLQLSDKDLSRL 134 Staphylococcus aure...
15900305  63 NGQLQNEVeHAKMSKIIDRYR--PAG---EGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNA---YFKLGLDRSQLAQE 134 Streptococcus pneum...
15674902  63 NGILQNDEeHTKISAIIDQFR--QPG---QAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQ---LFDTQLDQKALAQK 134 Streptococcus pyoge...
13541151  63 NGTESKDE-NRSVKSVLERYRN-ELQS--FFGKKDVSYSSLNYGILSGSSDAGAASIGAILSF----IDKKNDIHDIEND 134 Thermoplasma volcanium
13541257  95 DGVTDEKY-LRKAKFALDYFRK-EFRIkgSFDFYIRRYRRYTKAKGLSESSAVAAAVSRALIKnvfGEGPALDDVFVSKY 172 Thermoplasma volcanium
13541613  88 EGENSPNi-TKKAMTAINVFKN-LYDIkgSFHFYLRIKRKYAGAKGLGESAAVAAAASRSLVSalfEKEALKDSNFISIV 165 Thermoplasma volcanium
16081580 112 NGRQDEQT-MIMARRVVQLLRSiYSIRg-SFHVYIKVDNKQGGGCGHWESAAVAAAFARSVARsvfDESAIEDGPFLSKM 189 Thermoplasma acidop...
15789800  68 DGDTVTGHgADRIRSVVDAVRD-RAGf--DHRVRLESQNSFPTNIGLGSSSSGFAAAALACVR---AAGLDLDLPTVSTV 141 Halobacterium sp. N...
16081942 202 ARLVSGSGTRAAHDGI-SMWLSYP-GMDSRDCVAFKVGKS--NENLNYGVFPKYSDVATDNAHSI-AVNSVFYGTWVSEK 276 Thermoplasma acidop...
15595031 128 ARVGSASAARAIYGGFtILKEGSK-----ESFQLRDQSYFndLRIIFAIIDSNEKELSSRAAMNIcKRHKFYYDAWIASS 202 Lyme disease spiroc...
15926269 135 ARIGSGSASRSIYGGF-AEWEKGYnDETSYAVPLESNHFEddLAMIFVVINQHSKKVPSRYGMSLtRNTSRFYQYWLDHI 213 Staphylococcus aure...
15900305 135 AKFASGSSSRSFYGPL-GAWDKDS-GEIYPVE----TDLK--LAMIMLVLEDKKKPISSRDGMKLcVETSTTFDDWVRQS 206 Streptococcus pneum...
15674902 135 AKFASGSSSRSFFGPV-AAWDKDS-GAIYKVE----TDLK--MAMIMLVLNAAKKPISSREGMKLcRDTSTTFDQWVEQS 206 Streptococcus pyoge...
13541151 135 IRMISESAGRSLHGGLtITWSDGY--SAYTERVLGPEHFN---NYAIVGFSFDYPRNPSDTIHQN-IIKSKRYKQRTIDA 208 Thermoplasma volcanium
13541257 173 ARLVSGSGTRAAHSGI-SIWLSYP-GINLRECAAFRVADD--PHDVYYGIFPKYTDIATDSAHSV-AVKSIFYASWLEDK 247 Thermoplasma volcanium
13541613 166 ARLASGSGSKSVAGPL-SLWLTAP---AVSHEGSFSLNLRkeIDDIFLCAVPIRDSVSTAEAHNT-VIKSPFYQQWSRLQ 240 Thermoplasma volcanium
16081580 190 ARLVSGSGAASTTGPLsVLISWPG----YAHDTSFALGLPmpDTGIALCAVPIAADFHRSNIHEV-ALRSPFYREWATYT 264 Thermoplasma acidop...
15789800 142 ARRGSASAARAVTGGFsDLHAGLN----DADCRSERLDAPaeFASDLRIVVGEVPAYKETESAHAeAADSHMFDARLAHV 217 Halobacterium sp. N...
16081942 277 FSN--VKRLISDHFDINDLLKIGENDMLRLNSILMSG--GLIIQTPDSLRILKEILKFKS--KNeGFYFTADTGPSIAIF 350 Thermoplasma acidop...
15595031 203 KKIfkDALYFFLKKDFIHFGATIVKSYQNMFALMFASs--IFYFKNSTIDLIRYAADLRN--EGiFVFETMDAGPQVKFL 278 Lyme disease spiroc...
15926269 214 DEDlaEAKAAIQDKDFKRLGEVIEENGLRMHATNLGStpPFTYLVQESYDVMALVHECREa-GY-PCYFTMDAGPNVKIL 291 Staphylococcus aure...
15900305 207 EKDyqDMLIYLKENDFAKIGELTEKNALAMHATTKTAspAFSYLTDASYEAMAFVRQLREk-GE-ACYFTMDAGPNVKVF 284 Streptococcus pneum...
15674902 207 AIDyqHMLTYLKTNNFEKVGQLTEANALAMHATTKTAnpPFSYLTKESYQAMEAVKELRQe-GF-ACYFTMDAGPNVKVL 284 Streptococcus pyoge...
13541151 209 DEHahEIKEMARTDDIEGIFEKAEEDTEEYHSILREVg--VLVIRENMQKLIEFIKILRKefWN---SYIVTGGSNVYVI 283 Thermoplasma volcanium
13541257 248 YAN--IKRLIEHNFDIDELLISGENDMLKLNAILFSG--GLIIQTGESLRILRAIQDFK---KNgDLFFTADTGPSIMVL 320 Thermoplasma volcanium
13541613 241 FDA--VYSIISRGGYSAQIIENATTNTYLMHSVLISTg--KLLWNQDTLRAMGIVEDMRRi-GR-LIGFSIDTGPSVLVM 314 Thermoplasma volcanium
16081580 265 RHA--LLDLLNSEFDADTIIRTATNSSLMMHATLMSSr--SILWTEKTIDVVSRILEMRS--GGrAVGFSIDAGPSVVLM 338 Thermoplasma acidop...
15789800 218 QGQlaEMRDAVRAGDFQRVFETAEHDSLSLAATTMTGpsGWVYWKPETLSIFETVRELRA--DGvPTYFSTDTGATVYVN 295 Halobacterium sp. N...
16081942 351 SFDRSLIDEFRENVNDEYIEGSYDFKGYNNRMRDFIRE 388 Thermoplasma acidophilum
15595031 279 CLEENLNTILKGLKQNFTG-IDFIVSKVGCDLEWI--- 312 Lyme disease spirochete
15926269 292 VEKKNKQQIIDKLLTQFDNNQIIDSDIIATGIEIIE-- 327 Staphylococcus aureus subsp. aureus N315
15900305 285 CQEKDLEHLSEIFGHRYRL-----IVSKTKDLSQDDCC 317 Streptococcus pneumoniae TIGR4
15674902 285 CLEKDLAQLAERLGKNYRI-----IVSKTKDLPDV--- 314 Streptococcus pyogenes M1 GAS
13541151 284 VRRDDLERLIHIKNTFGSKPKILNVAGPAWIKKVESD- 320 Thermoplasma volcanium
13541257 321 SRDKSLIEELRQSVEDPYIEGTYNFNRHTRDLNNFTKE 358 Thermoplasma volcanium
13541613 315 ADREDLIKEFKERYNGECIDASVPNGAPDIPSSFVESA 352 Thermoplasma volcanium
16081580 339 ARNAAELDEARRSIDAECVDGSITSGEPSIPPEFLRMA 376 Thermoplasma acidophilum
15789800 296 TTASHADEVEAAVADCGVDTAVWEVGGPAHELDERDAI 333 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap