Conserved Protein Domain Family
YqjF

?
COG3361: YqjF 
Uncharacterized protein YqjF, DUF2071 family [Function unknown]
Statistics
?
PSSM-Id: 225897
View PSSM: COG3361
Aligned: 4 rows
Threshold Bit Score: 351.2
Threshold Setting Gi: 15790672
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15841400  17 RALAGYPVTPPALPRPVIFDQRWTDLTFIHWPVLPESVAGSYPPGTRPDVfADGMTYVGLVPFRMSSTKLGTALPIPYVG 96  Mycobacterium tuber...
1731069    1 MTERFQQKNISVPDGIWIMKQTWNDVLFAHWPVDVSILRALVPSVLELDT-YNGQAWISMLPFMLTNLRARYLPVIPGAR 79  Bacillus subtilis
15609064  16 RALAGYPVTPPALPRPVIFDQRWTDLTFIHWPVLPESVAGSYPPGTRPDVfADGMTYVGLVPFRMSSTKLGTALPIPYVG 95  Mycobacterium tuber...
15790672   1 ---------------MDVLSMRWADVLVASWPVDPEVVADRLPDGVDVDT-HDGDAYLSVVPFVMENIRP-RGLPSGVGR 63  Halobacterium sp. N...
15841400  97 TFPETNVRLYsIDNAGRHGVLFRSLETARLTVVPLTRIGLGIPYAWSRMRMMR-SGKHITYHSVR--RWPRRGLRSLLTI 173 Mycobacterium tuber...
1731069   80 AFPELNLRTY-VTYKGKPGIYFFSLDADHRLAVLGARTFFHLPYFYADMKSEK-NGDAIDYVSKR--KNDKEAAFHAAYR 155 Bacillus subtilis
15609064  96 TFPETNVRLYsIDNAGRHGVLFRSLETARLTVVPLTRIGLGIPYAWSRMRMMR-SGKHITYHSVR--RWPRRGLRSLLTI 172 Mycobacterium tuber...
15790672  64 TFGELNLRTY-VTVDGRPGIYFFNLDATDALGVRVARRLFGLPYYTADMRIERrAGGALAVRSTRthAGQPSLAFDATYE 142 Halobacterium sp. N...
15841400 174 TIGDLVEPTP--LEVWLTARWGAHTR-KAGRTWWVPNEHKPWPLRAAEIAELNDELIDASGVQPTGDRLRALFSPGVHAR 250 Mycobacterium tuber...
1731069  156 PI---SAP---------------FTAeKDSLDYWLTDDTGSTPLIAISSITKTSIIIRGCCKTPKQKFQSIR-------- 209 Bacillus subtilis
15609064 173 TIGDLVEPTP--LEVWLTARWGAHTR-KAGRTWWVPNEHKPWPLRAAEIAELNDELIDASGVQPTGDRLRALFSPGVHAR 249 Mycobacterium tuber...
15790672 143 QAGACSRATPgsLTAFLLERYRFFVAsEDGTVYQGAVDHDPWQLADATLDVRRNDLFTANGFEQPAGSPHIAYSPGVDVT 222 Halobacterium sp. N...
15841400 251 FGRPCVV 257 Mycobacterium tuberculosis CDC1551
1731069      -------     Bacillus subtilis
15609064 250 FGRPCVV 256 Mycobacterium tuberculosis H37Rv
15790672 223 AGLPTVV 229 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap