Conserved Protein Domain Family
COG3355

?
COG3355: COG3355 
Predicted transcriptional regulator [Transcription]
Statistics
?
PSSM-Id: 225891
View PSSM: COG3355
Aligned: 20 rows
Threshold Bit Score: 102.352
Threshold Setting Gi: 15897388
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20090517   1 MVDSIHEMIRASFRCEDMVKCVLGLKSLDIEAYKILL--MHGPLTTDGLGEILNRERSTAYRSLQNLITCGVVYRETRSL 78
gi 11499431   5 KFTGDIMEATCSPDLKCVLKCALNISCLEMDVYLILL--KNPGLDVETIAKELEKDESTVYKALRNLMERGLVKREYRIL 82
gi 20093195   1 --MGMIDFACKEFRIEDVIKCALNLTKADLNVMKHFLnePEKWVDTDTLSKSLNLDISTVQRSVKKLHEKGILQRSQQNL 78
gi 3025174    1 MSKLLLKTPCTTWTFDSLMACVFGIKVSDVKVYFDIL--KNGPSKINDIAERINRDRSTVQRAVQNLMNAGLVKRKQVNI 78
gi 20094237   3 ADVPFVTVRRLNVTVRDVLRCVLGLRDVEVDTYFALL--ERGEATVYDLAEELDRDRTTVQKALKSLVYAGLVTRRKETR 80
gi 15897018   8 EGTRIKLPSGKDAGLVDILSFCYGLSETDVTVLLALM--KGDARGTEELESDLKLSKASINRSLNKLLEMGLVMRIKEPG 85
gi 15897963   1 MAEKVRFPDGREVDIHDFIAFMYGLSKSDVEVLHILLq--NGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPA 78
gi 18202253   4 ENIRVRLPSGKEVGLVDALNFCYDISDTDFQVLKTLL--NSGPKTEDELAEMLHLSKASINRSVNKLVSLGFVDRVKDSS 81
gi 15897972   1 --MSLKLSESK-----EVIRCCYKISDTDVECLFKLVe-LNRPISAEELASIMKLSKTTVENSLKKLIEIGLIVRNKDGE 72
gi 15899216   3 GKTEINMPDGRVADIFNVIKFLYGLSDRDIEILKLLLk-SQNPLTMEEISSKLNITKSVVNKSILNLEKKNIIIKEKIET 81
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|.
gi 20090517  79 ----ESGGYYHEYVAIEPWEMKQMVKKNVDEWYCQMNGLIEKMDDKVSTLI 125
gi 11499431  83 ----KGGGYKYLYFPKDFEEFKKIAKDAMEEWFRHFDSMIKDIEKVDKEEL 129
gi 20093195  79 ----DGGGYVFIYKIHSRNQIKNVILKIVNSWADRLGQELEQWENGG---- 121
gi 3025174   79 ----KDGGYYYVYEAIPFEETKKIIKKTMEEWCNNMKKWVEELEFEDVVKE 125
gi 20094237  81 ----PRGGFVYVYKAVPFEEARKIVLRALDEWYEAVKDALERADVPRSGPE 127
gi 15897018  86 n---KAGRPRYLYKARDYAELKGKMLSDIKDCADKMAQLVEKEFKPL---- 129
gi 15897963  79 ekeeRKGRPNYIY-WVEKERLYRKLEADLEKLAGTVKEALQKHTALEIVI- 127
gi 18202253  82 s---KGGRPRYIYKPIDADRITTKISNDFKYCADLFSSVIPQELKEK---- 125
gi 15897972  73 eg-kRIGRPKYLYAVIHNAETK--IKQDLTNCASKILSATSS--------- 111
gi 15899216  82 s---KKGRRAYTY-KVDSNYLNKKLLVDLDQLMKDLKVKIANVIGVEIEKT 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap