Conserved Protein Domain Family
FimD

?
COG3188: FimD 
Outer membrane usher protein FimD/PapC [Cell motility, Extracellular structures]
Statistics
?
PSSM-Id: 225729
View PSSM: COG3188
Aligned: 70 rows
Threshold Bit Score: 138.979
Threshold Setting Gi: 15892564
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15836686  42 TQIRGRYFKQRVLVAAIASTCTLmmsrlacaetepdnlgqrllvakadntaPQRVAQTANFNNSFLVGQ----ARSVDLG 117 Xylella fastidiosa ...
15599847   1 -MPRPCQRRSRRHRSLLIGL----------------------------------ALLSPVHAADYLAG-----LPPPQPA 40  Pseudomonas aerugin...
15892564     -------------------------------------------------------------------------------- Rickettsia conorii
17547412   1 ---------------------------------------------------------------MTLAN------DAPAPS 11  Ralstonia solanacearum
17549717   1 ----MAAGCGIVLVTLQTAQAG--------------------------------ALAPAQADPVALLAA-----ARPDAP 39  Ralstonia solanacearum
16767813   3 YLKLPLYIKTALYCSLATTTFS-------------------------------ALAEELNFDMGILTSR----GISPNVA 47  Salmonella typhimur...
16121956   1 ---MIIRFRLPPLSVLIYGS----------------------------------ILLPSLIPLTILGGS----LPPPSTS 39  Yersinia pestis
13476410   1 --MPTFRSRASRVAITAVVT-A---------------------------------FSTMQVKAQDVLPA----PAATDSA 40  Mesorhizobium loti
16331404   5 FPSPVLVIILANCLMTVVGLILPqsart-------------------etfsADFPPPDSALDLLLGQETplmeTTIPEPE 65  Synechocystis sp. P...
1176192    1 ---MLKKTLLAYTIGFAFSPPANa---------------------------DGIEIAAVDFDRETLKSl----GVDPNIS 46  Escherichia coli
15836686 118 MFSRGN------PVIAGLYR-ADLYVNGQWKGRRD-MEFRNTK--------DDKEAVTCMTLAM--LDELGID------- 172 Xylella fastidiosa ...
15599847  41 PSGGG-----------NVLYyLELVINGRDSGQVV-PVN-AA------------DGHYLLDAAA--LREAG--------- 84  Pseudomonas aerugin...
15892564     -------------------------------------------------------------------------------- Rickettsia conorii
17547412  12 RTAASD---------VAELL-LQFDLNQQGLDDTV-LLLKTK------------GGELYASAED--LKRWRLR------- 59  Ralstonia solanacearum
17549717  40 LPAAG----------TDDLY-LEAIINGTPTHTIA--RLRLR------------DGRLSAAAGE--LRALGIR------- 85  Ralstonia solanacearum
16767813  48 QYFSRAp-----RFLPGSHT-VMVKINGVNRGSLV-ARFDTEG-------------QLCVDDDF--LSASG--------- 96  Salmonella typhimur...
16121956  40 TTMP------------DTTLyLELVVNDRNFGSTV-PIS-YR------------NNRYYLSQSQ--LRTIG--------- 82  Yersinia pestis
13476410  41 AAPAD-----------GRDLyLEVFVNDVSTGLIG-AFRQLS------------DGGLASTPDE--LQQVG--------- 85  Mesorhizobium loti
16331404  66 QGQEDNqsappsEPTPGNLG-NEDDLFERVFGRPRpTGVQRLVapffindlQQGQIVVFVSLGGgsSLQITAStlllkme 144 Synechocystis sp. P...
1176192   47 HYFSRSa-----RFLPGEYS-LIVSVNGEKKGNIA-TRFDEN-------------GDICLDQAF--LQQAGLK------- 97  Escherichia coli
15836686 173 TSALTDSAADMQ-------ACKTIDQWLPDAYARFDVATQRLDVSIPQAAMRRSA----RGYVSP----SLWDHGVNAGF 237 Xylella fastidiosa ...
15599847  85 ---VRLPGn---------pAGQVAVDALPEVRADYDSASQQLHLQVPPDWLPEQR----FDDPGlv--aRAPARSSLGAL 146 Pseudomonas aerugin...
15892564     -------------------------------------------------------------------------------- Rickettsia conorii
17547412  60 ---QPEATPLAHn-----nEVFYPLKAITGLSYQLDETLLTVAVTAPAQAFLPNAf---DEANKPv--aLSLKPG-FGGF 125 Ralstonia solanacearum
17549717  86 ---IDDLQPDAN--------GLIALDGVAGLRYTYEVRAQQVRFVLDDARRVPDVl---TVHARP----RVPPTSGTGLV 147 Ralstonia solanacearum
16767813  97 ---LVSLNISAKe------TCHSLQEDYPSAIITPLPNSESLELFVPAQALDNN-------LLSL----NNVIKGGTAGL 156 Salmonella typhimur...
16121956  83 ---LPISEp---------lAPEIAIDNMAGVNVKYDGENQRLLINVPSEWLPKQQ----IEVTEqd--dFNLAQSSLGAL 144 Yersinia pestis
13476410  86 ---LQPVEGAMg------aDHLVRVDRLPDVSYRIDEATQRLYVTATNAARSAHV----IDIAPqgkqdRLKPQSGFGGV 152 Mesorhizobium loti
16331404 145 EYARPDIQTRLAdlvddsgNLTLAALQSVGLDATFNDQLLELRIIIPPNLRKTIVygsgNLQLPPga-aTALRPSNFSGF 223 Synechocystis sp. P...
1176192   98 ---IPSEEKNG---------CYDYILSYPGTTITPLPNQEALDIIVSPQAIIPIG----LDLTNA-------ATGGTAAL 154 Escherichia coli
15836686 238 IGYAFNWYGGRNANAINSRRrsdSAYLGINSGLNLGDWQFRHNSSYSWHS-NEG-----SLWQNISTYAQRAFPNTSSML 311 Xylella fastidiosa ...
15599847 147 FNYDLYYSD-----PADGATp--WLSALLEQRLFDGFGVISNTGVYTRYFgDADnld--srYLRYDTYWLYNDERNMHSY 217 Pseudomonas aerugin...
15892564   1 -----------------------MYSYSFLFQTEAVKSNFSKITNTTKNQ---------NKFTRLDTNWTYENVDKMTNW 48  Rickettsia conorii
17547412 126 LNYDLLAEHATGQTR--SSG---LFEAGVFNGLGVGVASFVANSGDTEHR-----------LIRLETTWTKDLPDHLSSV 189 Ralstonia solanacearum
17549717 148 LNYDAYLQPTTPGGDGASLG----VFS--EQRFFHPGGVFSNSGVALAARg-------aDRYTRLETSWSHADPERLTTL 214 Ralstonia solanacearum
16767813 157 FNYNLYASRSESSGS-DSRN---YAQANLEAGLNFAEWTLRSRYMLTNNDg-------eYRTDSLYTYAEHVFQAQKMRA 225 Salmonella typhimur...
16121956 145 FNYDIYATQG---YPYSSLT---HFSAWTEQRIFDRFGLLSNTGVYRTHFpSNNntddaKGYIRFDTQWQKNDEEHLLRY 218 Yersinia pestis
13476410 153 LNYSLFASINDLKDRTSQLFs--GVSGGFDARLFSPYGTLSQGFIVSLS----Dgel--dgFTRLNTTWSYSDPERLLTY 224 Mesorhizobium loti
16331404 224 INLIGTQPYAWDGTGDLGRQ---ALNLGVEGALNYQGWVLEGSASFAEQSn--------NPWTRSDIRLVKDDPDNAVRY 292 Synechocystis sp. P...
1176192  155 LNYSLMSSRAEFSNGSSDYS-----QAALEGGININDWMLRSHQFLTQTNg-------tFSNQNSSTYLQRTFTDLKTLM 222 Escherichia coli
15836686 312 TVGDAYT-SGELFDS-IGFRGISLATDDRMLPDSLRGYAPIVRGIA-QSNARVEIHQNGQLIYSTTVAPGAFVIDDLYPT 388 Xylella fastidiosa ...
15599847 218 QLGDYVN-GALNWTTpVRMGGFRFARNFGVRPDLVTYPLLRFDGQA-AVPSTVDLFINGYKASSADLQPGPFAISNVPYI 295 Pseudomonas aerugin...
15892564  49 WVGDNSItKVSSWSNsTRFAGIQYATNFAVRPNLVTYPLLDFRGKS-ELPSSIEIFSNSIPIYNTKAHMGDFDITNIPVI 127 Rickettsia conorii
17547412 190 RLGDSIS-RAGAWGRsVRFGGIQYSTNFAVQPGFVALPLQSIGGQA-ALPSTVDVYVNNVLSSRKDVAPGPFSITNVPVV 267 Ralstonia solanacearum
17549717 215 RLGDTVT-AALGWSRaVRLGGVQWQRNFDLRPDLVTYPLPLLSASA-AVPTAVDLYVNNVRQFSGQARGGPFVLNAAPAV 292 Ralstonia solanacearum
16767813 226 QVGQINV-NSSLFSG-APINGVQLIPEQGLAQDTQ---GVTINGIArTHQARVEVRQSGQIIYTAPVNAGAFTLENVPII 300 Salmonella typhimur...
16121956 219 STGDLIT-GALPWSSaIRLGGIQIARHFAIRPDLITYPLPQFSGQA-AVPSTVDLYIDNFRTQSANINPGPFVINNAPRI 296 Yersinia pestis
13476410 225 KAGDFVS-GGLAWTRsVYLGGFQVQRNFSLRSDLVTLPLPNFSGTA-AVPSTLEVYTQNVRTYTSDVPAGPFQVTNLPIF 302 Mesorhizobium loti
16331404 293 VLGDLFS-TARSYQSfVPMVGFAMFRNFSLQPYLTTRPTGQFEFLL-ESPARVEIFVNGLLRQTLQLPAGPQDIRNFGLN 370 Synechocystis sp. P...
1176192  223 RAGEVNL-NNSVLEG-ASIYGIEIAPDNALQTS---GSGVQVTGIAnTSQARVEIRQQGVLIHSILVPAGAFTIPDVPVR 297 Escherichia coli
15836686 389 GYGGDLQVTVYETDGRQQQFSVPYGSVPQMLRAGSQRYSLTAGKIRN-----NNLSHTPYLLEGTYQRGISNALTAYAGS 463 Xylella fastidiosa ...
15599847 296 NGAGEATVVTTDAQGRQVVTSLPFYVSNTLLARGLSDFDLSVGRLRDdyglrNFSYAD-NAASGIYRYGVSDRLTLSTHA 374 Pseudomonas aerugin...
15892564 128 TGRGDLIVKTQDITGKV--------------------------------------------------------------- 144 Rickettsia conorii
17547412 268 TGQGDVRVVVRDLLGREQVISVPFYASASLLAKGLHDFSYEAGAERRnfgtdSNDYGR-AFAAATHRLGFTDWLTGEVHA 346 Ralstonia solanacearum
17549717 293 TGAGQAVIVVKDALGRDVVTSVPLYIDTGLLAAGLSDYAVEAGFLRNqygvhTFDYARSPALSASLRYGLSGSLTLESHA 372 Ralstonia solanacearum
16767813 301 RSNTDLNVSVVETDGSTTTFTVP-AVSFNLRELTPAGLTMSIGRIRDt----TSDYSLPWIYNISDGWKLSENWLAQASG 375 Salmonella typhimur...
16121956 297 NGAGQATIVTTDALGRQISTSVPFYVASTLLKPGVWDFSLSGGALRRnyairSADYGE-MVASGVVRYGTTPWLTLEGRG 375 Yersinia pestis
13476410 303 TGAGQAQIVLRDSLGRETTVTLPFYNSSMLLKRGLLDFSAEVGSPRRnfgveSYDYDGGIYGSASARYGLTNRLTLEGHV 382 Mesorhizobium loti
16331404 371 TGLNNVTVKIIDSAGRVEELSFSAPLATDLLAVGLNQFGLGVGVPAYttngvRSYDTSRPIIGGFYRQGITSTLTLGGYL 450 Synechocystis sp. P...
1176192  298 NGNSDLNVTVVETDGSSHNYIVP-STLFNQHVESFQGYRFAIGRVDD------DYDESPWVISASSGWNLTRWSAMNGGV 370 Escherichia coli
15836686 464 TISQRYIAAIAGAGLST-PVGAFSLDGT--VARTKL--RNDTFS----GTSLRLSYSKLLS--PTNTNITLAAYRYSTSG 532 Xylella fastidiosa ...
15599847 375 EAASDLRLLGIGGDIAVaTFGTLSLAASg---sDGQg---------------------dS------GQQYLLGYSYYSRR 424 Pseudomonas aerugin...
15892564     -------------------------------------------------------------------------------- Rickettsia conorii
17547412 347 ESQLERQTVGLGTVMLApSVGVFSAAAA--ASRGRQ------Gs----GGLVSVGFERQASpvSVGVHAQLASPRFTQLG 414 Ralstonia solanacearum
17549717 373 EAARGLANLGAGMRTRLgQAGVVSGAAS--VARGGD------AS----GAQGSLGY--QYR--APGIAIDLQGTRT---- 432 Ralstonia solanacearum
16767813 376 vLAQDYQAAGGMLQWLPtNKWTFSGSMLg--SKASFg---ESLQ----GAKSELRASMALP---GEIRLDVSTARYS-DG 442 Salmonella typhimur...
16121956 376 DIAKEMHVIGGGVNFRMgLLGVLNSAYSisNTSNGAfnNVAEPLntnnATPNRLPSPAASR--RGRGNQRSLGYSYSNAF 453 Yersinia pestis
13476410 383 EGGEDLVNGGAGIAFPLsYFGAASIAAAgsRHNGQTgaLVN-----------------AS------LELSYDGWSLYGRM 439 Mesorhizobium loti
16331404 451 Q-AAGSQQLIGTEGTLAtSVGNFGWDAAleNDGNGL---DHAFRl---RYQFLALGGNQAQlpNFGLEVEYLGPYFQRFG 523 Synechocystis sp. P...
1176192  371 IVAENYQAASIRSSLVPlPDLTVSSQIS----TSQD--TKDSLQ----GQKYRLDANYNLP----FSLGLTTSLTRSDRH 436 Escherichia coli
15836686 533 FYGLQEAIMAMDYERrGLSTASIYRQRSQ-----LQLTVSQQLG----QYGSLYLTGSARQYWNQ-RGNTIQYQGGYNVS 602 Xylella fastidiosa ...
15599847 425 LGLSLQHIERSAGY--GDLGTLDGEYQL-------SRRTDQATAsltfDEQGT-IGTGYFDIRARdGSRTRLANLSYSRP 494 Pseudomonas aerugin...
15892564     -------------------------------------------------------------------------------- Rickettsia conorii
17547412 415 LELDMPAPRLLS-----------------------SVNVGMALP----GGGSLGLAYVYLDNRDG--HPTQLASASYGTQ 465 Ralstonia solanacearum
17549717 433 FGTYQDLASTAGAP--------FYRSl-------LRGTVSRPVG----RTGSVALSYIGLSVPGS--DRSRIVSLSYAAL 491 Ralstonia solanacearum
16767813 443 YRELTDALNKDAY---------EYQSSS-------SANIAWNHN----LLGTFSLGYYTYQATDN-DNDSRSIMASWGKT 501 Salmonella typhimur...
16121956 454 FNLNAQHIISSDEY--SDLANYKTPSLL-------SRRMTQLTGslslGSYGT-VGSGYFDVRDAlGEQTRLINISYSTS 523 Yersinia pestis
13476410 440 QRAFADYEDIASVT--AEINAVPGPNEFPiftagVPRALDQVTLsvpmPLDFSNLNLSYAHLTSAeGESSQIVGVSYSQT 517 Mesorhizobium loti
16331404 524 SFPIGFTAEPLDFFG-----TTTNNVSWS-----FGANYSQTLI----DGLGINLGLGYQLGSFG-QPNAYRAAIGFTTN 588 Synechocystis sp. P...
1176192  437 YRELSEAIDDDYTDP----------TKST-----YALGLNWSNS----ILGGFNISGYKTYSYDG-DNDSSNLNINWNKA 496 Escherichia coli
15836686 603 YKG-VSYGLSALRSQIP-----SMPSDT-QMLFTVSVPLGKanPVIVTSQIGSRDGRYDNSRVSLVGASGKDSALTYGIA 675 Xylella fastidiosa ...
15599847 495 IGSrSSFYLALNKDLD-------GDGYS--ALMQLVIPFDI--NGLLNIGVTRDSDRRYSERVIWSRSTPSQGGLGWNLG 563 Pseudomonas aerugin...
15892564     -------------------------------------------------------------------------------- Rickettsia conorii
17547412 466 LGRfGFISLALSKTLHQ------PGGLM--VGLNWTLPLGe--RTTTSIN-MTQQQGRTEVQAQVQQGLPPGDGFGYSVR 534 Ralstonia solanacearum
17549717 492 LGRdLSLSASAYQDLA-------DSRAR-GVLLTFSMALGR--DANAAAS-VGSDHGRAEATVSAVRTPDYAGGFGWQLQ 560 Ralstonia solanacearum
16767813 502 FKY-ASITANWQHAVNQddenhNDSNDDdMFYINISIPLG---EQRVGAY-MRNQGDKTTYGLQNNGSLSKDTHYYISAD 576 Salmonella typhimur...
16121956 524 LLRnSNFYSALNRELG-------RKGYN--VQLVWSIPLGP--RGSSSISATRTNDNQWIQQLNYSRSAPSNGGLGWNLA 592 Yersinia pestis
13476410 518 VFKdSSFYATAFTDLDD------KNSFG--VFAGISVPLGG--DVTASTGVADGPDGVSVVADIAKSERLENGSIGWRAR 587 Mesorhizobium loti
16331404 589 LGRgLQANLTLNNRLDQ-----SGRAET-QVLFNFLQTSQF--QSLTARSNLSSQREQASTLTWTSRSPAQYNSVNTSVN 660 Synechocystis sp. P...
1176192  497 FKH-ATVSVNWQHQLSAs---eNNEDDGdLFYVNISIPFGR--SNTATLY-TRHDDHKTHYGTGVMGVVSDEMSYYVNAE 569 Escherichia coli
15836686 676 ASDARNS--ATMIDGNVQYRSRYAALSGSYSHNRNYNQMSLGASGSIVLHSGVATLAP-QRGDTMVIIEAPA-AKGARVS 751 Xylella fastidiosa ...
15599847 564 YGgg----aSRYQQADLTWRMQNVQLQGGLYGETGNYTRWADLSGSLVWMDNAVFASN-RINDAFVLVSTKG-YPQVPIR 637 Pseudomonas aerugin...
15892564     -------------------------------------------------------------------------------- Rickettsia conorii
17547412 535 ASQLg------AWDAALNAQNRVGTYLLEAAGDRGQTGVRMGASGGIAIL-DGLHLSR-RISDSFAVVKVPD-FPNVRIY 605 Ralstonia solanacearum
17549717 561 SGRSg---aQRRSLAQVNYRGRYGDAFAAVQEINGQASTALDAAGSLVLMDGAVLPGR-RINDAFALVTTEG-MADVPVT 635 Ralstonia solanacearum
16767813 577 RDAKNQQn-SFNGNLNSNLHYTQLSVGGGTDGDN-YRNYNATFSGGIAAHEHGITFSPyTIKNTFAIARLSEpESGIEIA 654 Salmonella typhimur...
16121956 593 YAN-StnnnNQYQQADIVWRTSMMESRMGLYGNSNNYNYWGGLTGSLVVMNRSVYASN-MINDAFALVSTNG-FSNIPVS 669 Yersinia pestis
13476410 588 TSeg----gTPNRSAAVSYRSPRARVETGIQQFDKSVRGTAEVDGAIAVAGGGIFATN-RIDDAFAVVDVG--VAGVEVQ 660 Mesorhizobium loti
16331404 661 LSNNPNPg-YFGTGLGLTYRGFLGDINLNHDYDQASHRTNLNFGTALVYADGRFGWSR-PVRDSFVIFSRNPnFADQLVL 738 Synechocystis sp. P...
1176192  570 RDHDEREt-SLNGSISSNLHYTQVSLAAGASGSD-SRTYNGTMSGGIAVHDQGVTFSPwTINDTFAIAKMDNnIAGVRIT 647 Escherichia coli
15836686 752 NI-----SGVRIDSRGYAVVPYVSPYRMNTITLDPEGTDPDVELETSSQLIAPYAGAISKVTFGTR--KGRALIVNARTP 824 Xylella fastidiosa ...
15599847 638 YEn---qLMGSTDDNGHLLVPWVAAYYPAKFQIEPLDLPANVSAPEVEQRVAVRQGSGLLLDFPIR--AVVAASISLVDE 712 Pseudomonas aerugin...
15892564     -------------------------------------------------------------------------------- Rickettsia conorii
17547412 606 ADn---qLVAKTNASGEALIPRLRAYEKNAISLEQLDLPFDAKVGTLSLDAVPYYRSGMVLDFPVT--HAHDALMTLKLE 680 Ralstonia solanacearum
17549717 636 FEn---rLMGRTNAQGHLLVPDLVAYENNRVAIDPLALPINARLAASAATLAPTDRSGVLVHFHVE--TFRGAQLRLVDA 710 Ralstonia solanacearum
16767813 655 TPq----GRIWTDHWGQAVIPGLTEWRKSRVEVNANTLPKSMELANGIKNITVAHSAFRVLDFNVL--NTRRVMLAVKRP 728 Salmonella typhimur...
16121956 670 YEn---qLIGTTNAKGYLLIPTVASYYQAKFQIDPMNLPADVMLPNVERRLAIGERSGYLINFPIK--RISAVNIRITDA 744 Yersinia pestis
13476410 661 HQn---rPVGVSNRQGRILVPDLNSYEDNTISIDPRNLPVDADVPETRKIVVPAGRSGVVLDFGVSk-AADAALVSLVDG 736 Mesorhizobium loti
16331404 739 INpglygPVAEANDVGPGVVPDLSSYTLTTMRVDAPNMPLGYDLGNAVFNLLPSYKSGTLITVGTEstVFLRGTLVDKAG 818 Synechocystis sp. P...
1176192  648 SQa----GPVWTDFRGNAVIPSIQPWRTSGVEIDTASLPKNVDIGNGTKMIKQGRGAVGKVGFSAI--TQRRALLNITLS 721 Escherichia coli
15836686 825 TGKALPFGAQVIDAEGQ---SVGLVAQGSLIYIRAKDPQGRLTIKWGDQAAQQCHLEYQLpaneaSTRPSSFTTLEAICR 901 Xylella fastidiosa ...
15599847 713 RGEPLPLGSQAEETGSG---QRASVGWDGQVYFEGLQSDNQLRVVRPD--GRACQARFRLd----TRKPTVSQVGPLTCS 783 Pseudomonas aerugin...
15892564     -------------------------------------------------------------------------------- Rickettsia conorii
17547412 681 NGSDLPAGATVQISGQK---EAFPVGNDGVVYLTGLAAQNRLQANWR---GQSCDISVPFt----PGADPLPDLGIFVCK 750 Ralstonia solanacearum
17549717 711 LEQPLPAGSHATLARTG---ARYPIGYDGLAFIDALETED--IVRVDD-VDPPCAAHVVYp----ADAGALPTLGPLRCM 780 Ralstonia solanacearum
16767813 729 DGSWLPKGTSIVDEKNN---YLVSAVDSGRVFITDVGDNPALYAADDD-MNRLCRIHYTLqk--tQDKEAFYETAKGVCQ 802 Salmonella typhimur...
16121956 745 SGQDLPKGSAIYTTGNI---PISYVGWDGMVYIEQVAQLNNLRIIRADN-GTQCYSQFKLk----TTEG-IQDAGTTVCR 815 Yersinia pestis
13476410 737 KGTPIAVGAKGRVEGAD---EEFVIGYDGEAYIRTLHRQNAVAIELPD--GTSCRAEFAYr----AIPGQQVVIKQVICS 807 Mesorhizobium loti
16331404 819 NPIALQVGQVRSLSDPSwspLELFTNRAGRFALTGLGPGKYELQLFG---DPPRAIRFEIp----ADKTGIYDIGTVTIG 891 Synechocystis sp. P...
1176192  722 DGKKLPRGVAIEDSEGN---YLTTSVDDGVVFLNNIKPDMVLDIKDE---QQSCRIHLTFpe--dAPKDVFYETATGECQ 793 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap