Conserved Protein Domain Family
SeqA

?
COG3057: SeqA 
Negative regulator of replication initiation [Replication, recombination and repair]
Statistics
?
PSSM-Id: 225599
View PSSM: COG3057
Aligned: 8 rows
Threshold Bit Score: 299.077
Threshold Setting Gi: 1173426
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15602221   1 MKIIEVDEELYQYIASQTQSIGESASDILRRLLNFSNKAvektevppvavKTTEPAPTAPQPAVQAETEAVFENPkilpk 80
gi 15829972   1 MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAAS-----------QPAAPVTKEVRVASPAIVEAKPIKT----- 64
gi 1173426    1 MKIIEVDEELYQYIASQTRSIGESASDILRRLLSLPvhtsi----vndliITSAETDQKPKQAINVKEVNIKTTkkqs-- 74
gi 16764067   1 MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSATT-----------QPTASAVKGTPAAQP-VAEAKPVNP----- 63
gi 15642096   1 MKTIEVDEDLYRYIASQTLHIGESASDILRRLLNVDGEL-----------ATAAPAAEPKGIVVS-KDAAFDTK------ 62
gi 16122890   1 MKTIELDEELYRYIASHTQHIGESASDILRRMLKFTAG---------------QPVTDLSVSGAAVKVTAQPAP------ 59
gi 15800390   1 MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAAS-----------QPAAPVTKEVRVASPAIVEAKPIKT----- 64
gi 548916     1 MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAAS-----------QPAAPVTKEVRVASPAIVEAKPVKT----- 64
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15602221  81 kqsdesIQQVVTKVRDLLRSDAFQQESKAVVRFLNILKVLYRTNPESFAQATESLQGRTRVYFARDEGTLLMAGNQTKPK 160
gi 15829972  65 ------IKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPK 138
gi 1173426   75 ---itaINQIVEKVQTLLNSTEFQEESKAVVRFLAILRVLYRTNPESFAQATESLQGRTRVYFARDEATLLMAGNHTKPK 151
gi 16764067  64 ------VKDKVRAMRELLLSDEYAEQKKAVNRFMLILTTLYSLDHHAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPK 137
gi 15642096  63 -------IDGVKAMRSLLISDEFAGLKNAIDRFMLILSTLHRIDSASFSEATM-FKGRKRVYFADNEQTLLASGQTTKPK 134
gi 16122890  60 -------RDRVRAVRELLLSDEYAEQSRAVNRFMLVLSTLYTLDAQAFTEATESLHGRTRVYFAGDQQTLLQHGTHTKPK 132
gi 15800390  65 ------IKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPK 138
gi 548916    65 ------IKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPK 138
                       170       180       190       200
                ....*....|....*....|....*....|....*....|...
gi 15602221 161 QIPDTPYWVITNTNSGRKMLMLEGAMQSMHLPADLIEEVRSYF 203
gi 15829972 139 HVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI 181
gi 1173426  152 QIPDTPYWVITNTNSGRKMLMLEGAMQSMELPETLIDEVRSYF 194
gi 16764067 138 HVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI 180
gi 15642096 135 AIPNTPFWVITNNNTSRKQQMVEQVMVRMGFPSDIIEKVTHSI 177
gi 16122890 133 HVPGTPFWVITNTNTERKRSMVQHIMLAMQFPPELTDKVCGTI 175
gi 15800390 139 HVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI 181
gi 548916   139 HVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap