Conserved Protein Domain Family
SeqA

?
COG3057: SeqA 
Negative regulator of replication initiation [Replication, recombination and repair]
Statistics
?
PSSM-Id: 225599
View PSSM: COG3057
Aligned: 8 rows
Threshold Bit Score: 299.077
Threshold Setting Gi: 1173426
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15602221   1 MKIIEVDEELYQYIASQTQSIGESASDILRRLLNFSNKAvektevppvavKTTEPAPTAPQPAVQAETEAVFENPkilpk 80  Pasteurella multocida
15829972   1 MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAAS-----------QPAAPVTKEVRVASPAIVEAKPIKT----- 64  Escherichia coli O1...
1173426    1 MKIIEVDEELYQYIASQTRSIGESASDILRRLLSLPvhtsi----vndliITSAETDQKPKQAINVKEVNIKTTkkqs-- 74  Haemophilus influenzae
16764067   1 MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSATT-----------QPTASAVKGTPAAQP-VAEAKPVNP----- 63  Salmonella typhimur...
15642096   1 MKTIEVDEDLYRYIASQTLHIGESASDILRRLLNVDGEL-----------ATAAPAAEPKGIVVS-KDAAFDTK------ 62  Vibrio cholerae
16122890   1 MKTIELDEELYRYIASHTQHIGESASDILRRMLKFTAG---------------QPVTDLSVSGAAVKVTAQPAP------ 59  Yersinia pestis
15800390   1 MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAAS-----------QPAAPVTKEVRVASPAIVEAKPIKT----- 64  Escherichia coli O1...
548916     1 MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAAS-----------QPAAPVTKEVRVASPAIVEAKPVKT----- 64  Escherichia coli
15602221  81 kqsdesIQQVVTKVRDLLRSDAFQQESKAVVRFLNILKVLYRTNPESFAQATESLQGRTRVYFARDEGTLLMAGNQTKPK 160 Pasteurella multocida
15829972  65 ------IKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPK 138 Escherichia coli O1...
1173426   75 ---itaINQIVEKVQTLLNSTEFQEESKAVVRFLAILRVLYRTNPESFAQATESLQGRTRVYFARDEATLLMAGNHTKPK 151 Haemophilus influenzae
16764067  64 ------VKDKVRAMRELLLSDEYAEQKKAVNRFMLILTTLYSLDHHAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPK 137 Salmonella typhimur...
15642096  63 -------IDGVKAMRSLLISDEFAGLKNAIDRFMLILSTLHRIDSASFSEATM-FKGRKRVYFADNEQTLLASGQTTKPK 134 Vibrio cholerae
16122890  60 -------RDRVRAVRELLLSDEYAEQSRAVNRFMLVLSTLYTLDAQAFTEATESLHGRTRVYFAGDQQTLLQHGTHTKPK 132 Yersinia pestis
15800390  65 ------IKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPK 138 Escherichia coli O1...
548916    65 ------IKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQTKPK 138 Escherichia coli
15602221 161 QIPDTPYWVITNTNSGRKMLMLEGAMQSMHLPADLIEEVRSYF 203 Pasteurella multocida
15829972 139 HVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI 181 Escherichia coli O157:H7
1173426  152 QIPDTPYWVITNTNSGRKMLMLEGAMQSMELPETLIDEVRSYF 194 Haemophilus influenzae
16764067 138 HVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI 180 Salmonella typhimurium LT2
15642096 135 AIPNTPFWVITNNNTSRKQQMVEQVMVRMGFPSDIIEKVTHSI 177 Vibrio cholerae
16122890 133 HVPGTPFWVITNTNTERKRSMVQHIMLAMQFPPELTDKVCGTI 175 Yersinia pestis
15800390 139 HVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI 181 Escherichia coli O157:H7 EDL933
548916   139 HVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI 181 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap