Conserved Protein Domain Family
RsmC

?
COG2813: RsmC 
16S rRNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 225370
View PSSM: COG2813
Aligned: 37 rows
Threshold Bit Score: 140.1
Threshold Setting Gi: 17988242
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642295 108 HKVSMmsdsyIAHQATQANLQQNQR--PPVQLLTTLDPVPN-DASVVLLQLPKSNRHLVWILSQLRKALSPNIPIIAVNK 184
gi 15616937   1 ------------------------MnnNIVHNNLLISQEMIqNCDVIIYYWPKDKSEAKFQLMNIISCSPINTEIFIVGN 56
gi 15834583  36 RLDTAas-raHTQQFQHWQVLSRQMgdNARFSLVATADDVA-DCDTLIYYWPKNKPEAQFQLMNLLSLLPVGTDIFVVGE 113
gi 1176480   34 TLASKc---sSIQIWSCYFDYARTQs-AVNFSVEFQGQ-----ADLIVYYWTKNKQEVNFQLIQLLAQASIGQEILIIGE 104
gi 15599823  33 LPQAQg-------WS-WHAGEQAQLdaRFPGRSRFDTRAPTgAWTSAVLFLPKSRELTDYLLASLAARLP-GGELFLVGE 103
gi 15602823  34 QVPAR-----SVKVWSWYFDYAKSKs-AVDFSLTCEEK-----ADLMVFYWTKNKQEVQFQLMQLLAQAPIGQEMLIVGE 102
gi 16767797  36 RFECAas-raHTQQFHHWQVLSRQMgdNVRFSLVAQASDVA-DCDTLIYYWPKNKPEAQFQLMNILSLMPSGVDVFVVGE 113
gi 16120760  36 QFDAAgv-rvHTNQYHHWQLLSNTLeeNVQFGLLATAETLA-ACDTLIYYWPKSKQEAQFQLANLLSILPVGTDIFVVGE 113
gi 15804942  36 RLDTAas-raHTQQFQHWQVLSRQMgdNARFSLVATADDVA-DCDTLIYYWPKNKPEAQFQLMNLLSLLPVGTDIFVVGE 113
gi 732118    36 RLDTAas-raHTQQFHHWQVLSRQMgdNARFSLVATADDVA-DCDTLIYYWPKNKPEAQFQLMNLLSLLPVGTDIFVVGE 113
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642295 185 AKEIHTSTLNLFEKHLGPTTTSLAWKKHRLVFSSATVNPANEVNPECGWSIe---PYAITLTNLPNVYSGESLDLGSRFI 261
gi 15616937  57 NSSGVKSAPLMLKKWIELEKIDSAKHSILISGLIKKKAIFVLEDFFKTHLW-----KNLIIKSLPGVFGHKKIDSGSKLL 131
gi 15834583 114 NRSGVRSAEQMLADYAPLNKVDSARRCGLYFGRLEKQPVFDADKFWGEYS-----VDGLTVKTLPGVFSRDGLDVGSQLL 188
gi 1176480  105 NRCGVRSVEKTLSPYGEIAKIDSARRCGLYHFSLQNKPHFELKNFWRTYQHs--tLENLTIYSLPGVFSAAELDTGTELL 182
gi 15599823 104 KRGGIERASKQLAAYGKPRKLDSARHCQLWQVRIEQAPAEPDLHALAQRYSlplaDGELQVVSLPGVFSHGRLDRGSALL 183
gi 15602823 103 NRCGVRSVEKMLDAYGDIAKIDSARRCGLYHFCLKNTPHFALADYWKTYQHp--rLGDLRIYSLPGVFSANELDVGTDLL 180
gi 16767797 114 NRSGVRSAEPMLADYAPLNKVDSARRCGLYHGRLEKQPQFSLESWWAEYN-----IDGLTIKTLPGVFSRDGLDVGSQLL 188
gi 16120760 114 NRSGVRSAEEMLADFAQLAKIDSARRCGLYHGRLDKQPEFDADAWWESYQ-----VGGVTVKTLPGVFSRDSLDSGSHLL 188
gi 15804942 114 NRSGVRSAEQMLADYAPLNKVDSARRCGLYFGRLEKQPVFDADKFWGEYS-----VDGLTVKTLPGVFSRDGLDVGSQLL 188
gi 732118   114 NRSGVRSAEQMLADYAPLNKVDSARRCGLYFGRLEKQPVFDAEKFWGEYS-----VDGLTVKTLPGVFSRDGLDVGSQLL 188
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642295 262 LEHLPADPTLeDFIDLGCGNGVLSVRLGQLNPQAKITCVDESFMAIASAQKNLHDNLGKRdIHCIANNCLDGFPahSSSM 341
gi 15616937 132 ASTFSNRITG-KVLDIGCGTGFLSASLLYFSPDAILTLVDNNMYALKCSQYTLNSNKFNG-KIVYSNLYSNVFK--KFDL 207
gi 15834583 189 LSTLTPHTKG-KVLDVGCGAGVLSVAFARHSPKIRLTLCDVSAPAVEASRATLAANGVEG-EVFASNVFSEVKG--RFDM 264
gi 1176480  183 LSTIDNKIKG-KVLDLGCGAGVIGSMIKKRTPNAQITMTDIHAMALESARKTLSENQLQG-EVYASDVFSDIEG--KFDL 258
gi 15599823 184 LGQLQALPGG-HLLDFGCGAGVLGAVLKRRYPASRLSLLDVDAFAVESSRLTLAANGLDG-EVIAADGIDGAPR--ELAA 259
gi 15602823 181 LSTLDQPVRG-KVLDLGCGAGVIGAYIKQQYPQVELTMADIHALALASSQRTLAENQLEA-EVIASDVFSNVAG--KFDL 256
gi 16767797 189 LSTLTPHTKG-KVLDVGCGAGVLSAALASHSPKVRLTLCDVSAPAVEASRATLAANGLEG-EVFASNVFSEVKG--RFDM 264
gi 16120760 189 LSTFNEPFKG-SVLDVGCGAGVLASVLAQQSPKIKWTLSDVSAAAIEASRATLAVNNIEA-QVIASNVYSDIKG--RFEM 264
gi 15804942 189 LSTLTPHTKG-KVLDVGCGAGVLSVAFARHSPKIRLTLCDVSAPAVEASRATLAANGVEG-EVFASNVFSEVKG--RFDM 264
gi 732118   189 LSTLTPHTKG-KVLDVGCGAGVLSVAFARHSPKIRLTLCDVSAPAVEASRATLAANGVEG-EVFASNVFSEVKG--RFDM 264
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 15642295 342 IVCNPPFHQQQTITDHIAWQMFCDSKHVLKKGGKLWVIGNRHLGYDVKLARLFGksHVRVIANNSKFVILQAIKS 416
gi 15616937 208 IISNPPFHNDLQINFNIIEKMICGAKKYLTKTGELRFVTSRFINCHFLLNKFFQ--KYYVIKETSQYKVYQAFYK 280
gi 15834583 265 IISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYPDVLDETFG--FHEVIAQTGRFKVYRAIMT 337
gi 1176480  259 IISNPPFHDGIDTAYRAVTELITQAKWHLNQGGELRIVANSFLPYPELLRQHFN--DYQVLAQTGKFKVYSVKN- 330
gi 15599823 260 IVSNPPFHQGVHTDYQASERLLQRAAEHLAPGGELRLVANSFLKYPPLIERHLG--PCRTLAEGDGFRIYSARRS 332
gi 15602823 257 IISNPPFHDGIDTAYRAVSELIMQAKWHLVPGGELRIVANAFLPYPDLLDQHFG--SHCVLAKTTKFKVYSVRG- 328
gi 16767797 265 IISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYPKILDETFG--FHEVIAQTGRFKVYRTVMT 337
gi 16120760 265 IISNPPFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYPALLDAAFG--SHEVLAQNGRFKVYQATVG 337
gi 15804942 265 IISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYPDVLDETFG--FHEVIAQTGRFKVYRAIMT 337
gi 732118   265 IISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYPDVLDETFG--FHEVIAQTGRFKVYRAIMT 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap