Conserved Protein Domain Family
COG2605

?
COG2605: COG2605 
Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only]
Statistics
?
PSSM-Id: 225325
View PSSM: COG2605
Aligned: 9 rows
Threshold Bit Score: 419.861
Threshold Setting Gi: 16082515
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15839495   1 MAILRgrAPLRLGLGGGGTDVEPYSSQFGGRILSVTIDK-YAYAFAERG----TGDEIAFRspdRDRAgqASIDDLASLE 75  Mycobacterium tuber...
15896306   1 MIIRAk-APLRISFGGGGTDVEPYCNEYGGVVLNTTIDK-YAYCSIVPN----NTDSIVVNsldFDMTvkYNCNENLVYD 74  Clostridium acetobu...
15792743   1 MKTIRtqTPLRLGLAGGGTDINLYCDKYTGYVLNATISL-YIHCTLIKR----EDGKIIFDspdTNSYceYESKEFLGND 75  Campylobacter jejuni
15607257   1 MAILRgrAPLRLGLGGGGTDVEPYSSQFGGRILSVTIDK-YAYAFAERG----TGDEIAFRspdRDRAgqASIDDLASLE 75  Mycobacterium tuber...
13541335   1 MILSY--SPLRITFGGGGTDIEPFVSKYGGAVVNATIDRgVTVRYIDDG----YQTELSSR---------DFVKSYIINM 65  Thermoplasma volcanium
13541719   1 MIITK--TPLRITFVGGGTDIPEYYRKKGGAVVSAAINK-YIYVIVNKK----FDNKIRIS---YSKT--EMVDSVEDIE 68  Thermoplasma volcanium
16082515   1 MIITR--TPLRITFVGGGTDLPDFYTRHGGSVVSAAINR-YIYIIVNKK----FDSKIRVS---YSRT--EIVDKVDEIR 68  Thermoplasma acidop...
16082294   1 MYISY--SPLRITFGGGGTDVEPFLSKHGGAVVNATIDRgVSVRYIEDE----FQLELSSR---------DFVRSYIVNM 65  Thermoplasma acidop...
16330397   1 MLISR--APVRISFFGGGTDYPEYFLQHGGAVLATAIDK-FSYVTASPFlshlFDYSIRVS---YRKV--ELVKNPSEME 72  Synechocystis sp. P...
15839495  76 EDfPLHVAVYRRVIAEFNGGTPfpLQLATQVDAPP-GSGLGSSSALVVAMLLTTCALIGSSPGPYELARLAWEIERVDLG 154 Mycobacterium tuber...
15896306  75 GKlDLVKAALKR--MNINKG----CEVYLQCDAPA-GSGLGTSSTVVVALLGAMAKWKGVVLDQYALASIAYEVERKDLK 147 Clostridium acetobu...
15792743  76 GKlDIFKSIYNRIVKDFTKKPLs-FSLHTYSDVPS-GSGLGGSSTLVVGVIKAFAEWLNLPLGEYEIAKLAYEIEREDLG 153 Campylobacter jejuni
15607257  76 EDfPLHVAVYRRVIAEFNGGTPfpLQLATQVDAPP-GSGLGSSSALVVAMLLTTCALIGSSPGPYELARLAWEIERVDLG 154 Mycobacterium tuber...
13541335  66 HG-PSTVSSRMLDYLLRSGLRT--GRIIMSGDVPP-GSGLGSSSAAMSALVNLTSIIRKTKYNWESIARESYNIEKNYFH 141 Thermoplasma volcanium
13541719  69 H--PSVRESLK--LLGIDGG----IEILSISDIPSkGTGLGSSSTFLVGLLNALHAYKGELTSREELAREAVLIEREILK 140 Thermoplasma volcanium
16082515  69 H--PTVREALR--LLELDGG----IEILSISDVPSqGTGLGSSSSFLVGLLNALHAYKSEYVSNETLAEEAVKIEREILR 140 Thermoplasma acidop...
16082294  66 HR-AASVTKMMADFLSEAGITN--GRVIMSGDAPP-GSGLGSSSSAVSALMNLVNSIRGRTVDPATLAEESYNLERNHFH 141 Thermoplasma acidop...
16330397  73 H--VVFRECLK--FCGLEKD----IELHNVADLPA-FTGLGSSSAFTVSLLQALHSFKGEFIRPLDLAYEAIYVERHLVK 143 Synechocystis sp. P...
15839495 155 MAGGWQDHYAAAFGGFNFMESRPNGEVVVNPLRIRREVIAELEASLLLYFGGVSRLSSEVIADQQRNVVERDADALAATH 234 Mycobacterium tuber...
15896306 148 IDGGYQDQYAAAFGGFNFMEVDGSD-VVVNPLKINKGITNELQYNLLLCYTGNVHVSANIIKDQVNNYVEKKEEVVNAMH 226 Clostridium acetobu...
15792743 154 IVGGAQDQYAATFGGFNFMEFYNNKRVIVNPLRIKNWIASELEARTVLYFTNITREAKDIEEHKKGKLGDEK--SLEAMH 231 Campylobacter jejuni
15607257 155 MAGGWQDHYAAAFGGFNFMESRPNGEVVVNPLRIRREVIAELEASLLLYFGGVSRLSSEVIADQQRNVVERDADALAATH 234 Mycobacterium tuber...
13541335 142 IVLGLQDPYAIALGGFKFMEFNGDG-VKYEMLDKYGDFTSELEKRIILIYTGHTRQSSEVLIDQVRAATQGDQETTEKLL 220 Thermoplasma volcanium
13541719 141 EPGGKQDQYMAAYGGINLMNFNQDESVYVRPLSINAKSLEDFRNHLLLLYTGIQRNSTDIHKKQREEVIKK----EEYYD 216 Thermoplasma volcanium
16082515 141 EAGGKQDQYMAAYGGIDLLQFFQNGEVRVKPIPLNTERLKYLRDNTALLYTGVERSSTDIHTDQISKIDDH----IQEYL 216 Thermoplasma acidop...
16082294 142 VVLGKQDPYAIAYGGFKYMEFGADG-VKREDLGQYSEFTTELQRRILLVYTGKTRQSSEVLMEQVKASEMGDEKTDRNLL 220 Thermoplasma acidop...
16330397 144 DKVGCQDQLMAAMGGFNLVEFRKEDDIVVSRVTMAPERMAEFEEHIFIVFTGIKRRAANVVEKQLKRVGDN----RETLK 219 Synechocystis sp. P...
15839495 235 SICAEALEMKDLLVVGD-IPGFADSLLRGWQAKKRTSTRISNPAIEHAYQVAQSSGMVAGKVSGAGGGGFLMMIVDPRRR 313 Mycobacterium tuber...
15896306 227 EIKALAYAMKKELLRNN-LNNFGSLLHYGWEMKKKMSSRISNPQIDELYEAALKKGALGGKLLGAGGGGYLLVYCPYNKK 305 Clostridium acetobu...
15792743 232 AIKQDAIKMKEALFRAD-FGTLAQILGKSWRSKKIISEIVSNDELERIYKLAIDNGAYSGKTSGAGAGGFMFFFVDPTKK 310 Campylobacter jejuni
15607257 235 SICAEALEMKDLLVVGD-IPGFADSLLRGWQAKKRTSTRISNPAIEHAYQVAQSSGMVAGKVSGAGGGGFLMMIVDPRRR 313 Mycobacterium tuber...
13541335 221 QLKEVAFRLRKAVIDND-YSEFDQAINYGWEIKKTLGQKTTNRRVDTIIESALKNGASAARLMGGGSQGFILVLSRPGKI 299 Thermoplasma volcanium
13541719 217 EMKELAYTFFEAVYKAE-YPRIGAIMDANWKNKKKLTDGISNDIIDNLYELAMKKGAYGGKLIGAGGGGFLLFVCEPSDS 295 Thermoplasma volcanium
16082515 217 EMKKLAEEFAVKLYASD-IKELGEIMDRNWMLKRKLSGKITNDLIDRLYIRAKELGAYGGKLIGAGGGGFLLFFIDHNKR 295 Thermoplasma acidop...
16082294 221 QMKDVARRLRDAVVKND-MDEFAHQINRGWEIKKSLSSRITNDHIDRIIALALSNGAQAARLMGGGSQGFVLVMCKPENL 299 Thermoplasma acidop...
16330397 220 LMRAMVDKGWDILTSNQcLSAFGELLDQAWQAKRSLDVGISNGDIDRIYQQGREAGAWGGKLLGAGAGGFMLFFAPPSVH 299 Synechocystis sp. P...
15839495 314 IEVARSLERECGGSVApCLFTKGGAVTWHIP 344 Mycobacterium tuberculosis CDC1551
15896306 306 HVVAESLEKMGGQLTD-WNFDLGGMQSWVVD 335 Clostridium acetobutylicum
15792743 311 YNLIKALRKEQGYVQD-FSFTKEGVKSWRI- 339 Campylobacter jejuni
15607257 314 IEVARSLERECGGSVApCLFTKGGAVTWHIP 344 Mycobacterium tuberculosis H37Rv
13541335 300 NELQRAMMNASNFVVR-TSFDKRGTRRLFIR 329 Thermoplasma volcanium
13541719 296 DDIIKALSLRKID----FDFDFEGSRIIYVS 322 Thermoplasma volcanium
16082515 296 EN-LKELGLRQMD----YDFDFEGSRIIYYQ 321 Thermoplasma acidophilum
16082294 300 NYIQRRMMSISNFVVR-TSFDMKGTRMIGH- 328 Thermoplasma acidophilum
16330397 300 PRLAETFKDHQVLS---VKINAPGSQIIFS- 326 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap