Conserved Protein Domain Family
COG2521

?
COG2521: COG2521 
Predicted archaeal methyltransferase [General function prediction only]
Statistics
?
PSSM-Id: 225319
View PSSM: COG2521
Aligned: 7 rows
Threshold Bit Score: 412.595
Threshold Setting Gi: 20094033
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14601104  22 NMGSLRRIAVPSS-IAKELLGRCrewsRGERPPAKVRMGGLVFGLQCIDERAVLVSESGSRFVVDEHAASLGERSMAVVG 100
gi 15669418   3 KITLVLTMNYITSkIAKEILNSQs---EEIFLNLDLNKTEKKEKILIDREKKIAKFPEGD-VSFDILKKIAKDEGHIYFI 78
gi 20094033   5 RIRPTDFVAVVSHfEARELLRAVr---KGGEIEIQLDLGLHSGKARINGD---TVVIEGVELTRDELESMTGWKG-AYGL 77
gi 14521158   1 ----MQGVYFLTFrEAREILRAR----KIAKINPNLNKTA--ELIEVEVIDNYAVFPDGSRIKLELIRKIAEDEGTVYFF 70
gi 18312061   1 -MG-YVAVPVVSKwQIEDLLTKR------GEVSFDLEISKTVVEYRGGVAR-FQYNGVLYEIELDSLPEVDEESCEVYAL 71
gi 14590866   1 -----MMLYFITFrEARVLLKSR----DLALINVDLMKTG--KKIRVRVSKDYVEFPDGSRVKKEIIKRIAEDEGNVYFV 69
gi 15837413   1 MPASMKTPHYTGPlLTRDIGHAL----QEARSRGTATWSGSLDLGRTHTQVRIATDAWHAKTHTYPYPNRLKDRT-IYYW 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14601104 101 STGFMGVAEAYRGSYYKLVPLPGGkPPTLEINGIHMHRVAGTDPWSDALAKASLV-VKRGFRVLDTCTGLGYTSIAAIAR 179
gi 15669418  79 KDGEVFKAAISNNGYYKLVPTIP---PTIEINGIRMHRTKEVNPYEDTLNKINAVkVKKGEKVLDTCMGLGYTAIEAYRR 155
gi 20094033  78 TTDNVYRIEIRAEHYYKLLPVRPGeAPTIEIDGIRMHRTKWTDPWTDAGVKVGKVgVSEGDRVLDVCTGLGYTALRAVER 157
gi 14521158  71 KDGELYKAAIAGEHFYKLVPTIP---PTIEIDGIRMHRTKDTDPLRDTLAKVETVkPRRGENVLDTCMGLGYTAIESARR 147
gi 18312061  72 IGGEWRELSIAADRFYKLCVFNRGwAPTLMIDGITMH-SVLENPLLLTSRKVERA----WGRVFECCTGLGYTAIEALKK 146
gi 14590866  70 RDGEVFKAAIAGEHFYKLVPTIP---PTIEINGIRMHRTKGTDPLKDTIAKVNTVkPREGEVVLDTCMGLGYTAIESAKR 146
gi 15837413  76 DGQNFTAISRFSGSLIKLVPTPWG-VPTFEIDGIKMLPSLRVSPFEDARRKVALVrP-QGKTVLDTCGGLGYFAACCLEA 153
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14601104 180 GASLVYTVEVDEIVLQLAALNPWSHRLRDK-R---IRIILGDAVEVVRDFGDSAFDALIHDPPRFSKSTsSLYTLELYRE 255
gi 15669418 156 GA-EVITIEKNPNVLELAKINPYSEELFKG-G---IKIILGDAYDVIKRFKDEEFDVVIHDPPRFSLAG-HLYSEEFYKE 229
gi 20094033 158 GA-EVISVEKDRNVLEIAGANPWSRGLEEV------EILLGPAEEVVPSLDDE-FDAIVHDPPRLARAG-ELYSENFYRE 228
gi 14521158 148 GA-FVLTIEKDKNVIELAKINPWSRELFEWpN---IKVIHGDSYELVKNFDNESFDVIIHDPPRFSLAG-ELYSREFYEE 222
gi 18312061 147 GARHVITVEVDPHVLTLASLNPYSRGLWSP-A---VDVILGDCYAFVQTVRDSSIDFIIHDPPRLSHATqRLYSEALYRE 222
gi 14590866 147 GA-RVITIEKDPNVIELAKINPWSRELFESpK---IKILQGDSFDLIKKFEDESFDVIIHDPPRFSLAG-ELYSEEFYME 221
gi 15837413 154 GAIHIRSFEKNPDVLWLRTLNPWSPNPQAIqAnqrLELVGGDIAQAIEDLPDASVDAILHDPPRFSIAG-ELYALRFYDQ 232
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 14601104 256 FHRILRRGGRLFHYTGEPG-RIRGLNLPGRVARLLREAGFEVLGFRRRALGLVAVKM 311
gi 15669418 230 IFRVLKPGGRLFHYVGNPGkKYRGKDLQKGVMERLRKVGFVNVKRVEEALGVVAVKP 286
gi 20094033 229 LLRLLRPGGRLVHYVGAPGsRYRGKDVLAGVSRRLTRVGFEVVDVDRRWGLVTAEKP 285
gi 14521158 223 LYRILKPGGRLFHYVGNPGkKYRRKDMQRGVMERLRSVGFIKVKKVEEALGVFALKP 279
gi 18312061 223 FYRILKRGGGVFHYVSQSGtKYRGLNPYKGVAERLRRVGFA-VEKIKEGYGIYARRR 278
gi 14590866 222 MFRVLKPGGRLFHYVGNPGkRYRGLDLQKGVMERLRRVGFMKVRRVQEALGVFALKP 278
gi 15837413 233 LARVLCRDGQMFHYTGTPTqLSHGRDVPREIARRLEQAGFQ--STLILDG-VLAQRR 286
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap