Conserved Protein Domain Family
YeiB

?
COG2311: YeiB 
Uncharacterized membrane protein YeiB [Function unknown]
Statistics
?
PSSM-Id: 225193
View PSSM: COG2311
Aligned: 20 rows
Threshold Bit Score: 140.933
Threshold Setting Gi: 15612920
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
19553116   1 MSDsaptthtkAVRTAQKTRILSPDIARGIALLGIALANVSTAWIAAPAGSTAas-lgGIVHDSIFEKIYAVFSAMFIHV 79  Corynebacterium glu...
15612920     -------------------------------------------------------------------------------- Bacillus halodurans
15613146   1 -------------MLNGQSRIRLLDILRGFAILGTLGTNIWLFAYLGDLSYVLty--dHSRWWASSDDFIRLLVLFLVNG 65  Bacillus halodurans
15613608     -------------------------------------------------------------------------------- Bacillus halodurans
15613609   1 MTTkv-----qVTPTLESNRIEALDIMRGFALLGILLVNMRHFQY-GLFPEYT-----MPAPTSFLDSGADALISILAQG 69  Bacillus halodurans
15615989   1 ----------------MNERIQTIDVLRGLCLFGILQANLLIFQYGIWGKDEIs-----LFSLSPFDTMSYYAVKLFIEA 59  Bacillus halodurans
15616255   1 MNTy------kLEP-VTKERVHELDIIRGFALVGILLANMMYFATPGIYVQMAg----SSSWTGALDQAAYMFITFFASG 69  Bacillus halodurans
1731134    1 MIVqke---grGQPVSLRERVHFLDIVRGFALLGIIIVNYFLIVDSVKGFEMA----------S--DDVLHKLVSWFAEG 65  Bacillus subtilis
1176968    1 MSS--------LQPTLTNERIGVLDVLRGMAIFGILFVNLAHFSYPDMYLSMLgkenfFMDKWSEADFAAADILKFFIQT 72  Bacillus subtilis
15807244   4 PLPpevaflppEGPAPVRERALLPDVLRGIALLGILTVNMQDFAGYREWEQVG------------LDRTAQVLIDVFANG 71  Deinococcus radiodu...
19553116  80 RGLPMFSTLLGYGVGMIVYSLWRRQYPDTAARgvlLRRYGFLALFGVIHMVFLFWGDIMFFYGVAGMIFAMLMTLKDKTL 159 Corynebacterium glu...
15612920     -------------------------------------------------------------------------------- Bacillus halodurans
15613146  66 KFLGLLTTMFGVGLELKYRQALRHGSPWPGMY---IWISLILLLEGLLHFTLVMEYDILMSYAFTAIIVSFIVKRGDQAI 142 Bacillus halodurans
15613608     -------------------------------------------------------------------------------- Bacillus halodurans
15613609  70 SFYTLFSFLFGYGMALMKDRFIEQKQGFVAVY---WRRTLILLLLGYVHGLFIWDGDILFMYAICGFLLFFFLKLTERGL 146 Bacillus halodurans
15615989  60 SFMPIFAFLFGYGMVIMRERSMERDGKPKRKL---ARRFLFILFLGYLHSTFLWEGDILLTYGMIGFILLLFVARKKKTI 136 Bacillus halodurans
15616255  70 KFFPMFSFLFGLGFVVFFQRAMQRSDRPYSLY---LRRIFFLFMFGIIHAFGIWYGDILLIYALLAPVLLLFYNRKGKTI 146 Bacillus halodurans
1731134   66 KFVTLFSFLFGVGFMIFMDRAAQKVESPNKLF---ARRLSILLGFGILHITFVWVGDILAFYAVSGFLLLAFYKRTAKTV 142 Bacillus subtilis
1176968   73 KCILLFSFLFGFGMVVMMERAENKGKRFVPLY---VRRLMALLLFGTIHAFLIWDGDILTEYALLGFVLLLFRKAKPKTL 149 Bacillus subtilis
15807244  72 RFISIFAMLFGWGAYGLYRR------HGPALF---ARRHLLLFALGTAHHIFLWHGDIIGLYAAIALGLPLVARLRVRGL 142 Deinococcus radiodu...
19553116 160 WWIAGSMSAIYVIVGIT---LGVVLPLYFGVS-----------TDTMASLDLTFDsYLEYLGMGLLSVPIQIGSVPVEIL 225 Corynebacterium glu...
15612920     -------------------------------------------------------------------------------- Bacillus halodurans
15613146 143 KRALKWVGGFHLLLVSL---ILLVSVL-----------------IYLSGGTLALGsMGHTIALYQHGSWLEQLLYRINHF 202 Bacillus halodurans
15613608   1 --------------------------------------------------------MARFVEFRRTADPTGLGVLGDILI 24  Bacillus halodurans
15613609 147 LIWAL-ILLGIMAISAL---GELSMEEDP-FTeavf----qsiaAYSEDEAAVLS-SGTYGEVC---------------- 200 Bacillus halodurans
15615989 137 LIWATILLVLSSLFGLG---AEIAADSDEEVT------------SYIKTTNHVYQ-TGTYLDIKTHRNTSDPGDLLDMPK 200 Bacillus halodurans
15616255 147 LRWAFAILLVPTFLLFL---GMMALLLGDEASmvhgqeevqfaNEMMEQSLAVYG-SGTVLEIFQQRALD--YTFAFQGY 220 Bacillus halodurans
1731134  143 LRWIIALIVFQFLTPVFtmlYNVINTAGSKNP------------NFSEFTLFSHSsLTYMESISTRWTDMVTMAAGSFSM 210 Bacillus subtilis
1176968  150 LIWAVSLYLLFSIPFML---TSFDQSNGQewvq--------avtQQAKQAIHVYG-SGSLKDIAEQRIHDRLVYMSSNGM 217 Bacillus subtilis
15807244 143 LAVGGALGGWWLLKTLVaawSSALTEQGHRLR-----------FDGLPDLMFGLSyAQVMQTRLHNFSDEYLGGLIYNAP 211 Deinococcus radiodu...
19553116 226 MLMPVMIVGYIAARHRVLSRVDEFRKPLWIATWIFIAIAVLVGVPWGLAEIGVFSAQTATVFSGLn---------qAVGS 296 Corynebacterium glu...
15612920   1 -----------MARKHLLTEAHLHRKQLRRMAVVGISIALVGGLPLAIVGAHSWELSPIATGLIQ-----------AIHI 58  Bacillus halodurans
15613146 203 WILRSEAIFVLPMN-VFLFLSGVLFMRAGAFSPDQHGKRIRRKLLAVGMYVGIPLNLLIFVPGGIfd--------lSVRY 273 Bacillus halodurans
15613608  25 FVNNMISVIG-------MFLLGAFVHRKGWIANAAEHKAIFKRMLWIGLLIGFPIKIATVLSPANle--------tIQII 89  Bacillus halodurans
15613609     -------------------------------------------------------------------------------- Bacillus halodurans
15615989 201 EAFLFISVFAIVLITP-MFLYGMYAAKRKWFVHPAQEQGRYRKGLLFIPVGVTLKALPLLFSGIPvl--------gVLSL 271 Bacillus halodurans
15616255 221 LFMIPTILF--------MFLLGVYVAKTERYRNLQQQKPFLKKVWLTSLAIGLPFNLLFFYSSTQselflsmlaygIGVM 292 Bacillus halodurans
1731134  211 IYSMFLMFLLGVYFVKMEFFKDMEAKKPIWKRIWIISTIAFLITQSSILLDMFNLSENMLWKDISs---------vLGQN 281 Bacillus subtilis
1176968  218 LRINPLNYFFASIPYFSMFLLGAAAAKSRYLHEPEKHRKGLKRLWMAGLVIGIGAQVLYSVTHKE-----------ICLL 286 Bacillus subtilis
15807244 212 WIALLFCLGAAAARAEVLTRPERFGWLFRRLTVFALPLGLLLGAVLAFLNTRSDLTAGLLAIPVR--------------M 277 Deinococcus radiodu...
19553116 297 LTGPGIVAAVALLVQPLQRKINKGNghlplPIKMIAALGARSMSGYVGQSILFLILTQTYTLGLGQGGGILAEAGVATCV 376 Corynebacterium glu...
15612920  59 MSGIAGGCAYAALFGLLGPVVNRSAl----AIRALVALGKRSFTFYVFNETMLVLLLSPVALGLGGGLHSTGAAVTAILI 134 Bacillus halodurans
15613146 274 LFAPILSLGYMALIAFIFEKSKHLW-----IWGRLEDIGRMALSCYVLQNILASIIFYGWGFGLGGSVNSLTVVTIWLLI 348 Bacillus halodurans
15613608  90 IGGPLVALFYISCIALFSQTAQGKK-----LLKPFTYVGRLSLTNYLLQSLVFTTVFYGYGLGLYGSLGLFVGLLLSIGF 164 Bacillus halodurans
15613609     -------------------------------------------------------------------------------- Bacillus halodurans
15615989 272 PGSYVLAFGYIFLIAYCFAKWRSHP-----LFRAAANVGKLSLTNYLLQTVVCTFIFYGYGLGLFSRLGVFFGILLGIVL 346 Bacillus halodurans
15616255 293 LGGPALCLFYITSIGLLCQSNVWAN-----MLSPLRAVGRLALSNYLLQSLVCTTIFYSYGFGLFGQVGPLMWVMIALFL 367 Bacillus halodurans
1731134  282 GGLTGSMFYMSTFAMLFLYLPQLRG-----PMMIFTKVGRMSLTCYLLHSIIGTVLFLRYGFGLADHIQSAGTFMFSLAV 356 Bacillus subtilis
1176968  287 IGAPFLMFFYVTTVVYLYHKTRVRT-----VLQSFSAVGRMAFTNYLMQSIVCTWIFYHYGLGLYGKVYPAAGVLITIAV 361 Bacillus subtilis
15807244 278 AGGLLSALGYVGVLGLLHNQGRLG------HWRLFAASGRTALTNYLTQSLVMTTVFYPYTGAQWGRWGAADALGLALLV 351 Deinococcus radiodu...
19553116 377 WLLTLIGAYGLELAGKRGPFESMHRYIAYGKKGLQDPYVPK 417 Corynebacterium glutamicum ATCC 13032
15612920 135 WLTAVGLAFLLEKKNMRGPLEVLLRWLLDRNAPKLKQTQA- 174 Bacillus halodurans
15613146 349 SVLLASFATVWHHFFSLGPMETARKYLAGLPRRSIKHVSKD 389 Bacillus halodurans
15613608 165 FALQIVCSHFWLRHFRIGPMEWVWRAGTYLSIPKWRR---- 201 Bacillus halodurans
15613609     ----------------------------------------- Bacillus halodurans
15615989 347 FSLQLIGSTYYLKTRKSGPFEWLLRAFTHWTLPWKLTKRKE 387 Bacillus halodurans
15616255 368 FTSQVILSNIWTKRFRFGPAEWIWRSLTYGKRQPLLKK--- 405 Bacillus halodurans
1731134  357 YFVLMSFSTLWLKRFRYGPMELVWRKLTYGKVNGSPKATPL 397 Bacillus subtilis
1176968  362 CAVQMVFSHLWLRVFRMGPFEWLWRSATYLSWQPIAKKTKV 402 Bacillus subtilis
15807244 352 GLAQLPLSHWWLRWHARGPAEELLRRAVYGRLN-------- 384 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap