Conserved Protein Domain Family
YeiB

?
COG2311: YeiB 
Uncharacterized membrane protein YeiB [Function unknown]
Statistics
?
PSSM-Id: 225193
View PSSM: COG2311
Aligned: 20 rows
Threshold Bit Score: 140.933
Threshold Setting Gi: 15612920
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19553116   1 MSDsaptthtkAVRTAQKTRILSPDIARGIALLGIALANVSTAWIAAPAGSTAas-lgGIVHDSIFEKIYAVFSAMFIHV 79
gi 15612920     --------------------------------------------------------------------------------
gi 15613146   1 -------------MLNGQSRIRLLDILRGFAILGTLGTNIWLFAYLGDLSYVLty--dHSRWWASSDDFIRLLVLFLVNG 65
gi 15613608     --------------------------------------------------------------------------------
gi 15613609   1 MTTkv-----qVTPTLESNRIEALDIMRGFALLGILLVNMRHFQY-GLFPEYT-----MPAPTSFLDSGADALISILAQG 69
gi 15615989   1 ----------------MNERIQTIDVLRGLCLFGILQANLLIFQYGIWGKDEIs-----LFSLSPFDTMSYYAVKLFIEA 59
gi 15616255   1 MNTy------kLEP-VTKERVHELDIIRGFALVGILLANMMYFATPGIYVQMAg----SSSWTGALDQAAYMFITFFASG 69
gi 1731134    1 MIVqke---grGQPVSLRERVHFLDIVRGFALLGIIIVNYFLIVDSVKGFEMA----------S--DDVLHKLVSWFAEG 65
gi 1176968    1 MSS--------LQPTLTNERIGVLDVLRGMAIFGILFVNLAHFSYPDMYLSMLgkenfFMDKWSEADFAAADILKFFIQT 72
gi 15807244   4 PLPpevaflppEGPAPVRERALLPDVLRGIALLGILTVNMQDFAGYREWEQVG------------LDRTAQVLIDVFANG 71
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19553116  80 RGLPMFSTLLGYGVGMIVYSLWRRQYPDTAARgvlLRRYGFLALFGVIHMVFLFWGDIMFFYGVAGMIFAMLMTLKDKTL 159
gi 15612920     --------------------------------------------------------------------------------
gi 15613146  66 KFLGLLTTMFGVGLELKYRQALRHGSPWPGMY---IWISLILLLEGLLHFTLVMEYDILMSYAFTAIIVSFIVKRGDQAI 142
gi 15613608     --------------------------------------------------------------------------------
gi 15613609  70 SFYTLFSFLFGYGMALMKDRFIEQKQGFVAVY---WRRTLILLLLGYVHGLFIWDGDILFMYAICGFLLFFFLKLTERGL 146
gi 15615989  60 SFMPIFAFLFGYGMVIMRERSMERDGKPKRKL---ARRFLFILFLGYLHSTFLWEGDILLTYGMIGFILLLFVARKKKTI 136
gi 15616255  70 KFFPMFSFLFGLGFVVFFQRAMQRSDRPYSLY---LRRIFFLFMFGIIHAFGIWYGDILLIYALLAPVLLLFYNRKGKTI 146
gi 1731134   66 KFVTLFSFLFGVGFMIFMDRAAQKVESPNKLF---ARRLSILLGFGILHITFVWVGDILAFYAVSGFLLLAFYKRTAKTV 142
gi 1176968   73 KCILLFSFLFGFGMVVMMERAENKGKRFVPLY---VRRLMALLLFGTIHAFLIWDGDILTEYALLGFVLLLFRKAKPKTL 149
gi 15807244  72 RFISIFAMLFGWGAYGLYRR------HGPALF---ARRHLLLFALGTAHHIFLWHGDIIGLYAAIALGLPLVARLRVRGL 142
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19553116 160 WWIAGSMSAIYVIVGIT---LGVVLPLYFGVS-----------TDTMASLDLTFDsYLEYLGMGLLSVPIQIGSVPVEIL 225
gi 15612920     --------------------------------------------------------------------------------
gi 15613146 143 KRALKWVGGFHLLLVSL---ILLVSVL-----------------IYLSGGTLALGsMGHTIALYQHGSWLEQLLYRINHF 202
gi 15613608   1 --------------------------------------------------------MARFVEFRRTADPTGLGVLGDILI 24
gi 15613609 147 LIWAL-ILLGIMAISAL---GELSMEEDP-FTeavf----qsiaAYSEDEAAVLS-SGTYGEVC---------------- 200
gi 15615989 137 LIWATILLVLSSLFGLG---AEIAADSDEEVT------------SYIKTTNHVYQ-TGTYLDIKTHRNTSDPGDLLDMPK 200
gi 15616255 147 LRWAFAILLVPTFLLFL---GMMALLLGDEASmvhgqeevqfaNEMMEQSLAVYG-SGTVLEIFQQRALD--YTFAFQGY 220
gi 1731134  143 LRWIIALIVFQFLTPVFtmlYNVINTAGSKNP------------NFSEFTLFSHSsLTYMESISTRWTDMVTMAAGSFSM 210
gi 1176968  150 LIWAVSLYLLFSIPFML---TSFDQSNGQewvq--------avtQQAKQAIHVYG-SGSLKDIAEQRIHDRLVYMSSNGM 217
gi 15807244 143 LAVGGALGGWWLLKTLVaawSSALTEQGHRLR-----------FDGLPDLMFGLSyAQVMQTRLHNFSDEYLGGLIYNAP 211
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19553116 226 MLMPVMIVGYIAARHRVLSRVDEFRKPLWIATWIFIAIAVLVGVPWGLAEIGVFSAQTATVFSGLn---------qAVGS 296
gi 15612920   1 -----------MARKHLLTEAHLHRKQLRRMAVVGISIALVGGLPLAIVGAHSWELSPIATGLIQ-----------AIHI 58
gi 15613146 203 WILRSEAIFVLPMN-VFLFLSGVLFMRAGAFSPDQHGKRIRRKLLAVGMYVGIPLNLLIFVPGGIfd--------lSVRY 273
gi 15613608  25 FVNNMISVIG-------MFLLGAFVHRKGWIANAAEHKAIFKRMLWIGLLIGFPIKIATVLSPANle--------tIQII 89
gi 15613609     --------------------------------------------------------------------------------
gi 15615989 201 EAFLFISVFAIVLITP-MFLYGMYAAKRKWFVHPAQEQGRYRKGLLFIPVGVTLKALPLLFSGIPvl--------gVLSL 271
gi 15616255 221 LFMIPTILF--------MFLLGVYVAKTERYRNLQQQKPFLKKVWLTSLAIGLPFNLLFFYSSTQselflsmlaygIGVM 292
gi 1731134  211 IYSMFLMFLLGVYFVKMEFFKDMEAKKPIWKRIWIISTIAFLITQSSILLDMFNLSENMLWKDISs---------vLGQN 281
gi 1176968  218 LRINPLNYFFASIPYFSMFLLGAAAAKSRYLHEPEKHRKGLKRLWMAGLVIGIGAQVLYSVTHKE-----------ICLL 286
gi 15807244 212 WIALLFCLGAAAARAEVLTRPERFGWLFRRLTVFALPLGLLLGAVLAFLNTRSDLTAGLLAIPVR--------------M 277
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19553116 297 LTGPGIVAAVALLVQPLQRKINKGNghlplPIKMIAALGARSMSGYVGQSILFLILTQTYTLGLGQGGGILAEAGVATCV 376
gi 15612920  59 MSGIAGGCAYAALFGLLGPVVNRSAl----AIRALVALGKRSFTFYVFNETMLVLLLSPVALGLGGGLHSTGAAVTAILI 134
gi 15613146 274 LFAPILSLGYMALIAFIFEKSKHLW-----IWGRLEDIGRMALSCYVLQNILASIIFYGWGFGLGGSVNSLTVVTIWLLI 348
gi 15613608  90 IGGPLVALFYISCIALFSQTAQGKK-----LLKPFTYVGRLSLTNYLLQSLVFTTVFYGYGLGLYGSLGLFVGLLLSIGF 164
gi 15613609     --------------------------------------------------------------------------------
gi 15615989 272 PGSYVLAFGYIFLIAYCFAKWRSHP-----LFRAAANVGKLSLTNYLLQTVVCTFIFYGYGLGLFSRLGVFFGILLGIVL 346
gi 15616255 293 LGGPALCLFYITSIGLLCQSNVWAN-----MLSPLRAVGRLALSNYLLQSLVCTTIFYSYGFGLFGQVGPLMWVMIALFL 367
gi 1731134  282 GGLTGSMFYMSTFAMLFLYLPQLRG-----PMMIFTKVGRMSLTCYLLHSIIGTVLFLRYGFGLADHIQSAGTFMFSLAV 356
gi 1176968  287 IGAPFLMFFYVTTVVYLYHKTRVRT-----VLQSFSAVGRMAFTNYLMQSIVCTWIFYHYGLGLYGKVYPAAGVLITIAV 361
gi 15807244 278 AGGLLSALGYVGVLGLLHNQGRLG------HWRLFAASGRTALTNYLTQSLVMTTVFYPYTGAQWGRWGAADALGLALLV 351
                       410       420       430       440
                ....*....|....*....|....*....|....*....|.
gi 19553116 377 WLLTLIGAYGLELAGKRGPFESMHRYIAYGKKGLQDPYVPK 417
gi 15612920 135 WLTAVGLAFLLEKKNMRGPLEVLLRWLLDRNAPKLKQTQA- 174
gi 15613146 349 SVLLASFATVWHHFFSLGPMETARKYLAGLPRRSIKHVSKD 389
gi 15613608 165 FALQIVCSHFWLRHFRIGPMEWVWRAGTYLSIPKWRR---- 201
gi 15613609     -----------------------------------------
gi 15615989 347 FSLQLIGSTYYLKTRKSGPFEWLLRAFTHWTLPWKLTKRKE 387
gi 15616255 368 FTSQVILSNIWTKRFRFGPAEWIWRSLTYGKRQPLLKK--- 405
gi 1731134  357 YFVLMSFSTLWLKRFRYGPMELVWRKLTYGKVNGSPKATPL 397
gi 1176968  362 CAVQMVFSHLWLRVFRMGPFEWLWRSATYLSWQPIAKKTKV 402
gi 15807244 352 GLAQLPLSHWWLRWHARGPAEELLRRAVYGRLN-------- 384
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap