Conserved Protein Domain Family
UhpC

?
COG2271: UhpC 
Sugar phosphate permease [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 225180
View PSSM: COG2271
Aligned: 37 rows
Threshold Bit Score: 341.557
Threshold Setting Gi: 15791660
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15603308   1 MIGPFKPAPHIAELPADKIDARYRFLRWQVFAGIFFGYAAYYFVRANFDLAQKGLIEAGMYNKAELGIIGTGAGLAYGLS 80
gi 15791660     --------------------------------------------------------------------------------
gi 136772     2 LAFLNQVRKPTLDLPLEVRRKMWFKPFMQSYLVVFIGYLTMYLIRKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVG 81
gi 136772     2 LAFLNQVRKPTLDLPLEVRRKMWFKPFMQSYLVVFIGYLTMYLIRKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVG 81
gi 15603206   2 LSFLQEVRKPTLELPVEERRKLWFKPFMQSYLVVFIGYMAMYLIRKNFNIAQNDLIETYGLSKTQLGMIGLGFSITYGVG 81
gi 15925925   1 MNFFDIHKIPNKGIPLSVQRKLWLRNFMQAFFVVFFVYMAMYLIRNNFKAAQPFLKEEIGLSTLELGYIGLAFSITYGLG 80
gi 15674566   1 -------MEEDYNKREPEKFTQFLRRQKVVFFVAFFGYVCAYLVRNNFKLMSNTIMVQNgWDKAQIAILLSCLTVSYGLA 73
gi 20141687   1 MLTILKTGQSAHKVPPEKVQATYGRYRIQALLSVFLGYLAYYIVRNNFTLSTPYLKEQLDLSATQIGLLSSCMLIAYGIS 80
gi 20141884   2 LAFLNQVRKPTLDLPLDVRRKMWFKPFMQSYLVVFIGYLTMYLIRKNFNIAQNDMISTYGLSMTELGMIGLGFSITYGVG 81
gi 15804262   2 LAFLNQVRKPTLDLPLEVRRKMWFKPFMQSYLVVFIGYLTMYLIRKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVG 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15603308  81 KFFMASISDRSNPKVFLPFGLLLSGLCMTMMGLMPwa-tsGIAVMFIMIFLNGWFQGMGWPPCGRTMVHWWSKSERGSIV 159
gi 15791660   1 ----------------MALGLILCALVNVLLGFSN-----SFYAYVGFVIALGVFQGMGVGPSFITLANWYPKKERGIYT 59
gi 136772    82 KTLVSYYADGKNTKQFLPFMLILSAICMLGFSASMgsgsvSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGTFL 161
gi 136772    82 KTLVSYYADGKNTKQFLPFMLILSAICMLGFSASMgsgsvSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGTFL 161
gi 15603206  82 KTLVSYYADGKNTKQFVPFMLILSAICMLGFSASMgggsvSLFLMIAFYALSGFFQSTGGPSSYSTITKWTPRNKRGTYL 161
gi 15925925  81 KTLLGYFVDGRNTKRIISFLLILSAITVLIMGFVLsyfgsVMGLLIVLWGLNGVFQSVGGPASYSTISRWAPRTKRGRYL 160
gi 15674566  74 KFYMGALGDRVSLRKLFSISLGASALICILIGFFNs----SMVVLGILLVLCGVVQGALAPASQAMIANYFPNKTRGGAI 149
gi 20141687  81 KGVMSSLADKASPKVFMACGLVLCAIVNVGLGFSS-----AFWIFAALVVFNGLFQGMGVGPSFITIANWFPRRERGRVG 155
gi 20141884  82 KTLVSYYADGKNTKQFLPFMLILSAICMLGFSASMgagstSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGTFL 161
gi 15804262  82 KTLVSYYADGKNTKQFLPFMLILSAICMLGFSASMgsgsvSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRXKRGTFL 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15603308 160 SIWNTAHNLGGMVPGAMVLLas----------aVYFSTHGveatakdVWQQALYYPGIAAMIAAIPIYFMMKDTPQSCGL 229
gi 15791660  60 AVWNISHNIGGGIVAPIVSLsgfalaallgvsmANFNETY-------WHMNHFYTPAACAVIISLYALYAVKGNPKNEGL 132
gi 136772   162 GFWNISHNLGGAGAAGVALFg------------ANYLFDG-------HVIGMFIFPSIIALIVGFIGLRYGSDSPESYGL 222
gi 136772   162 GFWNISHNLGGAGAAGVALFg------------ANYLFDG-------HVIGMFIFPSIIALIVGFIGLRYGSDSPESYGL 222
gi 15603206 162 GFWNLSHNVGGAAAAAVALFg------------ANVFFNG-------HVIGMFVFPSIIALIIGFWGLRYGSDSPEAYGL 222
gi 15925925 161 GFWNTSHNIGGAIAGGVALWg------------ANVFFHG-------NVIGMFIFPSVIALLIGIATLFIGKDDPEELGW 221
gi 15674566 150 AGWNISQNMGSALLPLTIALlt---------smGLVVPANg------NILLAFLIPGVLVFLFALCCWKLGGDNPESEGL 214
gi 20141687 156 AFWNISHNVGGGIVAPIVga-----------afAILGSEH-------WQSASYIVPACVAVIFALIVLVLGKGSPRKEGL 217
gi 20141884 162 GFWNISHNLGGAGAAGVALFg------------ANYLFDG-------HVIGMFIFPSIIALIVGFIGLRFGSDSPESYGL 222
gi 15804262 162 GFWNISHNLGGAGAAGVALFg------------ANYLFDG-------HVIGMFIFPSIIALIVGFIGLRYGSDSPESYGL 222
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15603308 230 PPIEKWRNDYPDDYn--EKTYEHD---LSTKDIFVTYVLKNRLLWYIAIANVFVYLIRYGVLKWSPVYLGEVKHFNIKGT 304
gi 15791660 133 VDITEIN-EMRGIKt--EEIKAIEtpnLSSFEIFYHYVLKNKNAWYVAWMDTFVYMVRFGLISWLPIYLLETKGFNKEQI 209
gi 136772   223 GKAEELFGEEISEEd--KETESTD---MTKWQIFVEYVLKNKVIWLLCFANIFLYVVRIGIDQWSTVYAFQELKLSKAVA 297
gi 136772   223 GKAEELFGEEISEEd--KETESTD---MTKWQIFVEYVLKNKVIWLLCFANIFLYVVRIGIDQWSTVYAFQELKLSKAVA 297
gi 15603206 223 GKAEELFGEPLSEEd--LATEQNQ---LTKWQTFVQYILKNKVIWLLCFANIFLYIVRIGIDQWSPVYAYQELGFSKDAA 297
gi 15925925 222 NRAEEIWEEPVDKEn--IDSQG-----MTKWEIFKKYILGNPVIWILCVSNVFVYIVRIGIDNWAPLYVSEHLHFSKGDA 294
gi 15674566 215 DSLRTMYGDAGESAvasEEEKHN----LSYWQLIWKYVFCNPSLLLVAAVNVALYFVRFGIEDWMPIYLSQVANMSEAHI 290
gi 20141687 218 PSLEQMMPEEKVVLk--TKNTAKApenMSAWQIFCTYVLRNKNAWYISLVDVFVYMVRFGMISWLPIYLLTVKHFSKEQM 295
gi 20141884 223 GKAEELFGEEISEEd--KETEENE---MTKWQIFVEYVLKNKVIWLLCFSNIFLYVVRIGIDQWSTVYAFQELKLSKEVA 297
gi 15804262 223 GKAEELFGEEISEEd--KETESTD---MTKWQIFVEYVLKNKVIWLLCFANIFLYVVRIGIDQWSTVYAFQELKLSKAVA 297
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15603308 305 AWAYTIYELAAVPGTLLCGWVSDKVFKGKRGLTGFIFMILTTAAVVALWLNPATpeaelakyaghawyenpYQLMDFILM 384
gi 15791660 210 GIAFWLFEWAAIPSTLLAGYISDKIFKGYRMPPAIGAMVIIFFMIIGYFTSNNL-------------------YMVIFFA 270
gi 136772   298 IQGFTLFEAGALVGTLLWGWLSDLAN-GRRGLVACIALALIIATLGVYQHASNE-------------------YIYLASL 357
gi 136772   298 IQGFTLFEAGALVGTLLWGWLSDLAN-GRRGLVACIALALIIATLGVYQHASNE-------------------YIYLASL 357
gi 15603206 298 ISGFALFEVGALVGTFLWGYLSDLAN-GRRGLTACVALILIVFTLEFYQFATNE-------------------VMYLCAL 357
gi 15925925 295 VNTIFYFEIGALVASLLWGYVSDLLK-GRRAIVAIGCMFMITFVVLFYTNATSV-------------------MMVNISL 354
gi 15674566 291 HFAISMLEWVAIPGSLVFAWLAVRYPNKMAKVGAIGLFVLAAIVFVYERLTATGa---------------pNYFLLLVIA 355
gi 20141687 296 SVAFLFFEWAAIPSTLLAGWLSDKLFKGRRMPLAMICMALIFVCLIGYWKSESL-------------------LMVTIFA 356
gi 20141884 298 IQGFTLFEVGALVGTLLWGWLSDLAN-GRRALVACVALALIIATLGVYQHASNQ-------------------YVYLASL 357
gi 15804262 298 IQGFTLFEAGALVGTLLWGWLSDLAN-GRRGLVACIALALIIATLGVYQHASNE-------------------YIYLASL 357
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15603308 385 TTIGFLIYGPVMLIGLHALELAPKKAAGTSAGFTGLFGYLGGTVSASAVVGWAAEy------------yGWDGGFYVMIA 452
gi 15791660 271 AMAGCLVYIPQFLASMQTMEVVPAFAVGSCVGLHGFMSYVVGASLGTKA------------------------------- 319
gi 136772   358 FALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIGDSFAKLGLGMIADgtpv------fgltGWAGTFAALDI 431
gi 136772   358 FALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIGDSFAKLGLGMIADgtpv------fgltGWAGTFAALDI 431
gi 15603206 358 FVLGFLVFGPQLLIGVAAVGFVPKKAISVADGVKGTFAYLIGDSFAKLGLGMIADgtai------fgltGWAGTFAALNI 431
gi 15925925 355 FALGALIFGPQLLIGVSLTGFVPKNAISVANGMTGSFAYLFGDSMAKVGLAAIADptrnglnifgytlsGWTDVFIVFYV 434
gi 15674566 356 GILGSLIYGPQLIVNILTINFVPLNVAGTAIGFVGVTAYLIGNMGANWLMPILADgf------------gWFWSYIVVAA 423
gi 20141687 357 AIVGCLIYVPQFLASVQTMEIVPSFAVGSAVGLRGFMSYIFGASLGTSLFGVMVDk------------lGWYGGFYLLMG 424
gi 20141884 358 FALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIGDSFAKLGLGMIADgtpv------fgltGWAGTFAALDA 431
gi 15804262 358 FALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIGDSFAKLGLGMIADgtpv------fgltGWAGTFAALDI 431
                       490       500
                ....*....|....*....|....*..
gi 15603308 453 GGVLAILLMFITMIEESKHKARLEDHY 479
gi 15791660     ---------------------------
gi 136772   432 AAIGCICLMAIVAVMEERKIRREKKIQ 458
gi 136772   432 AAIGCICLMAIVAVMEERKIRREKKIQ 458
gi 15603206 432 SAIVCMVLLAFVAIAEEKKIRKIKAQA 458
gi 15925925 435 ALFLGMILLGIVAFYEEKKIRSLKI-- 459
gi 15674566 424 LSAFSAVGYLILAKREEEIIKD----- 445
gi 20141687 425 GIVCCILFCYLSHRGALELERQRQNAL 451
gi 20141884 432 AAIGCICLMAMVAVMEERKIRREKKIQ 458
gi 15804262 432 AAIGCICLMAIVAVMEERKIRREKKIQ 458
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap