Conserved Protein Domain Family
UhpC

?
COG2271: UhpC 
Sugar phosphate permease [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 225180
View PSSM: COG2271
Aligned: 37 rows
Threshold Bit Score: 341.557
Threshold Setting Gi: 15791660
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15603308   1 MIGPFKPAPHIAELPADKIDARYRFLRWQVFAGIFFGYAAYYFVRANFDLAQKGLIEAGMYNKAELGIIGTGAGLAYGLS 80  Pasteurella multocida
15791660     -------------------------------------------------------------------------------- Campylobacter jejuni
136772     2 LAFLNQVRKPTLDLPLEVRRKMWFKPFMQSYLVVFIGYLTMYLIRKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVG 81  Escherichia coli
136772     2 LAFLNQVRKPTLDLPLEVRRKMWFKPFMQSYLVVFIGYLTMYLIRKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVG 81  Escherichia coli
15603206   2 LSFLQEVRKPTLELPVEERRKLWFKPFMQSYLVVFIGYMAMYLIRKNFNIAQNDLIETYGLSKTQLGMIGLGFSITYGVG 81  Pasteurella multocida
15925925   1 MNFFDIHKIPNKGIPLSVQRKLWLRNFMQAFFVVFFVYMAMYLIRNNFKAAQPFLKEEIGLSTLELGYIGLAFSITYGLG 80  Staphylococcus aure...
15674566   1 -------MEEDYNKREPEKFTQFLRRQKVVFFVAFFGYVCAYLVRNNFKLMSNTIMVQNgWDKAQIAILLSCLTVSYGLA 73  Streptococcus pyoge...
20141687   1 MLTILKTGQSAHKVPPEKVQATYGRYRIQALLSVFLGYLAYYIVRNNFTLSTPYLKEQLDLSATQIGLLSSCMLIAYGIS 80  Salmonella typhimurium
20141884   2 LAFLNQVRKPTLDLPLDVRRKMWFKPFMQSYLVVFIGYLTMYLIRKNFNIAQNDMISTYGLSMTELGMIGLGFSITYGVG 81  Salmonella typhimurium
15804262   2 LAFLNQVRKPTLDLPLEVRRKMWFKPFMQSYLVVFIGYLTMYLIRKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVG 81  Escherichia coli O1...
15603308  81 KFFMASISDRSNPKVFLPFGLLLSGLCMTMMGLMPwa-tsGIAVMFIMIFLNGWFQGMGWPPCGRTMVHWWSKSERGSIV 159 Pasteurella multocida
15791660   1 ----------------MALGLILCALVNVLLGFSN-----SFYAYVGFVIALGVFQGMGVGPSFITLANWYPKKERGIYT 59  Campylobacter jejuni
136772    82 KTLVSYYADGKNTKQFLPFMLILSAICMLGFSASMgsgsvSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGTFL 161 Escherichia coli
136772    82 KTLVSYYADGKNTKQFLPFMLILSAICMLGFSASMgsgsvSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGTFL 161 Escherichia coli
15603206  82 KTLVSYYADGKNTKQFVPFMLILSAICMLGFSASMgggsvSLFLMIAFYALSGFFQSTGGPSSYSTITKWTPRNKRGTYL 161 Pasteurella multocida
15925925  81 KTLLGYFVDGRNTKRIISFLLILSAITVLIMGFVLsyfgsVMGLLIVLWGLNGVFQSVGGPASYSTISRWAPRTKRGRYL 160 Staphylococcus aure...
15674566  74 KFYMGALGDRVSLRKLFSISLGASALICILIGFFNs----SMVVLGILLVLCGVVQGALAPASQAMIANYFPNKTRGGAI 149 Streptococcus pyoge...
20141687  81 KGVMSSLADKASPKVFMACGLVLCAIVNVGLGFSS-----AFWIFAALVVFNGLFQGMGVGPSFITIANWFPRRERGRVG 155 Salmonella typhimurium
20141884  82 KTLVSYYADGKNTKQFLPFMLILSAICMLGFSASMgagstSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGTFL 161 Salmonella typhimurium
15804262  82 KTLVSYYADGKNTKQFLPFMLILSAICMLGFSASMgsgsvSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRXKRGTFL 161 Escherichia coli O1...
15603308 160 SIWNTAHNLGGMVPGAMVLLas----------aVYFSTHGveatakdVWQQALYYPGIAAMIAAIPIYFMMKDTPQSCGL 229 Pasteurella multocida
15791660  60 AVWNISHNIGGGIVAPIVSLsgfalaallgvsmANFNETY-------WHMNHFYTPAACAVIISLYALYAVKGNPKNEGL 132 Campylobacter jejuni
136772   162 GFWNISHNLGGAGAAGVALFg------------ANYLFDG-------HVIGMFIFPSIIALIVGFIGLRYGSDSPESYGL 222 Escherichia coli
136772   162 GFWNISHNLGGAGAAGVALFg------------ANYLFDG-------HVIGMFIFPSIIALIVGFIGLRYGSDSPESYGL 222 Escherichia coli
15603206 162 GFWNLSHNVGGAAAAAVALFg------------ANVFFNG-------HVIGMFVFPSIIALIIGFWGLRYGSDSPEAYGL 222 Pasteurella multocida
15925925 161 GFWNTSHNIGGAIAGGVALWg------------ANVFFHG-------NVIGMFIFPSVIALLIGIATLFIGKDDPEELGW 221 Staphylococcus aure...
15674566 150 AGWNISQNMGSALLPLTIALlt---------smGLVVPANg------NILLAFLIPGVLVFLFALCCWKLGGDNPESEGL 214 Streptococcus pyoge...
20141687 156 AFWNISHNVGGGIVAPIVga-----------afAILGSEH-------WQSASYIVPACVAVIFALIVLVLGKGSPRKEGL 217 Salmonella typhimurium
20141884 162 GFWNISHNLGGAGAAGVALFg------------ANYLFDG-------HVIGMFIFPSIIALIVGFIGLRFGSDSPESYGL 222 Salmonella typhimurium
15804262 162 GFWNISHNLGGAGAAGVALFg------------ANYLFDG-------HVIGMFIFPSIIALIVGFIGLRYGSDSPESYGL 222 Escherichia coli O1...
15603308 230 PPIEKWRNDYPDDYn--EKTYEHD---LSTKDIFVTYVLKNRLLWYIAIANVFVYLIRYGVLKWSPVYLGEVKHFNIKGT 304 Pasteurella multocida
15791660 133 VDITEIN-EMRGIKt--EEIKAIEtpnLSSFEIFYHYVLKNKNAWYVAWMDTFVYMVRFGLISWLPIYLLETKGFNKEQI 209 Campylobacter jejuni
136772   223 GKAEELFGEEISEEd--KETESTD---MTKWQIFVEYVLKNKVIWLLCFANIFLYVVRIGIDQWSTVYAFQELKLSKAVA 297 Escherichia coli
136772   223 GKAEELFGEEISEEd--KETESTD---MTKWQIFVEYVLKNKVIWLLCFANIFLYVVRIGIDQWSTVYAFQELKLSKAVA 297 Escherichia coli
15603206 223 GKAEELFGEPLSEEd--LATEQNQ---LTKWQTFVQYILKNKVIWLLCFANIFLYIVRIGIDQWSPVYAYQELGFSKDAA 297 Pasteurella multocida
15925925 222 NRAEEIWEEPVDKEn--IDSQG-----MTKWEIFKKYILGNPVIWILCVSNVFVYIVRIGIDNWAPLYVSEHLHFSKGDA 294 Staphylococcus aure...
15674566 215 DSLRTMYGDAGESAvasEEEKHN----LSYWQLIWKYVFCNPSLLLVAAVNVALYFVRFGIEDWMPIYLSQVANMSEAHI 290 Streptococcus pyoge...
20141687 218 PSLEQMMPEEKVVLk--TKNTAKApenMSAWQIFCTYVLRNKNAWYISLVDVFVYMVRFGMISWLPIYLLTVKHFSKEQM 295 Salmonella typhimurium
20141884 223 GKAEELFGEEISEEd--KETEENE---MTKWQIFVEYVLKNKVIWLLCFSNIFLYVVRIGIDQWSTVYAFQELKLSKEVA 297 Salmonella typhimurium
15804262 223 GKAEELFGEEISEEd--KETESTD---MTKWQIFVEYVLKNKVIWLLCFANIFLYVVRIGIDQWSTVYAFQELKLSKAVA 297 Escherichia coli O1...
15603308 305 AWAYTIYELAAVPGTLLCGWVSDKVFKGKRGLTGFIFMILTTAAVVALWLNPATpeaelakyaghawyenpYQLMDFILM 384 Pasteurella multocida
15791660 210 GIAFWLFEWAAIPSTLLAGYISDKIFKGYRMPPAIGAMVIIFFMIIGYFTSNNL-------------------YMVIFFA 270 Campylobacter jejuni
136772   298 IQGFTLFEAGALVGTLLWGWLSDLAN-GRRGLVACIALALIIATLGVYQHASNE-------------------YIYLASL 357 Escherichia coli
136772   298 IQGFTLFEAGALVGTLLWGWLSDLAN-GRRGLVACIALALIIATLGVYQHASNE-------------------YIYLASL 357 Escherichia coli
15603206 298 ISGFALFEVGALVGTFLWGYLSDLAN-GRRGLTACVALILIVFTLEFYQFATNE-------------------VMYLCAL 357 Pasteurella multocida
15925925 295 VNTIFYFEIGALVASLLWGYVSDLLK-GRRAIVAIGCMFMITFVVLFYTNATSV-------------------MMVNISL 354 Staphylococcus aure...
15674566 291 HFAISMLEWVAIPGSLVFAWLAVRYPNKMAKVGAIGLFVLAAIVFVYERLTATGa---------------pNYFLLLVIA 355 Streptococcus pyoge...
20141687 296 SVAFLFFEWAAIPSTLLAGWLSDKLFKGRRMPLAMICMALIFVCLIGYWKSESL-------------------LMVTIFA 356 Salmonella typhimurium
20141884 298 IQGFTLFEVGALVGTLLWGWLSDLAN-GRRALVACVALALIIATLGVYQHASNQ-------------------YVYLASL 357 Salmonella typhimurium
15804262 298 IQGFTLFEAGALVGTLLWGWLSDLAN-GRRGLVACIALALIIATLGVYQHASNE-------------------YIYLASL 357 Escherichia coli O1...
15603308 385 TTIGFLIYGPVMLIGLHALELAPKKAAGTSAGFTGLFGYLGGTVSASAVVGWAAEy------------yGWDGGFYVMIA 452 Pasteurella multocida
15791660 271 AMAGCLVYIPQFLASMQTMEVVPAFAVGSCVGLHGFMSYVVGASLGTKA------------------------------- 319 Campylobacter jejuni
136772   358 FALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIGDSFAKLGLGMIADgtpv------fgltGWAGTFAALDI 431 Escherichia coli
136772   358 FALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIGDSFAKLGLGMIADgtpv------fgltGWAGTFAALDI 431 Escherichia coli
15603206 358 FVLGFLVFGPQLLIGVAAVGFVPKKAISVADGVKGTFAYLIGDSFAKLGLGMIADgtai------fgltGWAGTFAALNI 431 Pasteurella multocida
15925925 355 FALGALIFGPQLLIGVSLTGFVPKNAISVANGMTGSFAYLFGDSMAKVGLAAIADptrnglnifgytlsGWTDVFIVFYV 434 Staphylococcus aure...
15674566 356 GILGSLIYGPQLIVNILTINFVPLNVAGTAIGFVGVTAYLIGNMGANWLMPILADgf------------gWFWSYIVVAA 423 Streptococcus pyoge...
20141687 357 AIVGCLIYVPQFLASVQTMEIVPSFAVGSAVGLRGFMSYIFGASLGTSLFGVMVDk------------lGWYGGFYLLMG 424 Salmonella typhimurium
20141884 358 FALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIGDSFAKLGLGMIADgtpv------fgltGWAGTFAALDA 431 Salmonella typhimurium
15804262 358 FALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIGDSFAKLGLGMIADgtpv------fgltGWAGTFAALDI 431 Escherichia coli O1...
15603308 453 GGVLAILLMFITMIEESKHKARLEDHY 479 Pasteurella multocida
15791660     --------------------------- Campylobacter jejuni
136772   432 AAIGCICLMAIVAVMEERKIRREKKIQ 458 Escherichia coli
136772   432 AAIGCICLMAIVAVMEERKIRREKKIQ 458 Escherichia coli
15603206 432 SAIVCMVLLAFVAIAEEKKIRKIKAQA 458 Pasteurella multocida
15925925 435 ALFLGMILLGIVAFYEEKKIRSLKI-- 459 Staphylococcus aureus subsp. aureus N315
15674566 424 LSAFSAVGYLILAKREEEIIKD----- 445 Streptococcus pyogenes M1 GAS
20141687 425 GIVCCILFCYLSHRGALELERQRQNAL 451 Salmonella typhimurium
20141884 432 AAIGCICLMAMVAVMEERKIRREKKIQ 458 Salmonella typhimurium
15804262 432 AAIGCICLMAIVAVMEERKIRREKKIQ 458 Escherichia coli O157:H7 EDL933
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap