Conserved Protein Domain Family
RfbX

?
COG2244: RfbX 
Membrane protein involved in the export of O-antigen and teichoic acid [Cell wall/membrane/envelope biogenesis]
Statistics
?
PSSM-Id: 225153
View PSSM: COG2244
Aligned: 113 rows
Threshold Bit Score: 67.8555
Threshold Setting Gi: 15679469
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13474395  73 EGSLRKSVGRGAVVTAMSQSVRVATQIISVIVLSRLLSPQDFGVVAMCAPVLAFIALFQ-DFGLTQATIQKSGIRHEEVN 151 Mesorhizobium loti
15832096  25 EQERYRIISLSVISSLISKILSLLSLILTVSLTLPYLGQERFG-VWMTITSLGAALTFL-DLGIGNALTNRIAHSFACGK 102 Escherichia coli O1...
2495677    1 -----MSLIKDSSIYLIGELSAKCVPFLLLPYLSRKLGVEGFGELSYYQTFLPLFVIFI-GLSQDGAVAR----YFYVYG 70  Haemophilus influenzae
16273587   1 --MIFMKVFKDSVIYLVGELSSKLVPFLLLPYLSRKLGVEGYGSLSYYQTFLSLFLIVV-SLTQEGAISR----YFYFYG 73  Haemophilus influen...
15679468   1 ---MEYVVITRAVEQVFMITMAVVFVMAGFYAAGAVIG-TSMGFLASAISAIIIFRRLInSYFPPAPPEKRLGLREELGL 76  Methanothermobacter...
14286014   1 -----MKAIKDSAIYLFGELISRSVPFLLLPYLSRKLGVEGFGELSYYQTYLALFLIIV-GLSQEGAIAR----FFYVYG 70  Pasteurella multocida
15899928   1 ----------------------------------------------------MYVFTIG-YFTIPANLFSLITSRYSAER 27  Sulfolobus solfatar...
13541485   1 ------MFTKKSPILVTQNIINAIAGYIGLFFITRYVGITIWGFVAFGMGFTGIFSLAT-ELGFSSAYTKSISEGKDVEE 73  Thermoplasma volcanium
16081702   1 ------MLSRKSPIIVTANIINAIAGYLGLFFITRYVGITIWGFVAFGMGFTGIFSLAT-ELGFSSAYTKSVSEGYDVRD 73  Thermoplasma acidop...
15802517  27 EQERYRIISLSVISSLISKILSLLSLILTVSLTLPYLGQERFG-VWMTITSLGAALTFL-DLGIGNALTNRIAHSFACGK 104 Escherichia coli O1...
13474395 152 YLFWINVAVSAILACVLAGAAPLVAAFYGEP---------------RVAGLVAAFGLQIMAYGLGAQHLALLTRRMQFGR 216 Mesorhizobium loti
15832096 103 NLKMSRQ-ISGGLTLLAGLSFVITAICYITSgmidwqlvikginenVYAELQHSIKVFVIIFGLGIYSNGVQKVYMGIQK 181 Escherichia coli O1...
2495677   71 KRSLNLV-VKTGYAYTLSIGGLGLLFCWLmqsei--------mfylVLSAIFQ-VFLSVQLSIRQCQKQAIPYTFIQVSS 140 Haemophilus influenzae
16273587  74 KRSLNLV-VNTGYAYTTIIGSIILIGCWIaqsei--------lfyaALSSIFQ-SFLNVQLSVRQCQKKAWSYAFIQFSL 143 Haemophilus influen...
15679468  77 VKTLISFSIPVIITALSEMAIYDISVFVIG-------------------Y-FMATTSVGYYTAADPVARLPLVISMSVAT 136 Methanothermobacter...
14286014  71 KRALNLV-VNAGYAYTLSIGSVILAFCLFfkaem--------laylALSAIFQ-SFLAVQLSVRQCQKQAVAYSVIQFLS 140 Pasteurella multocida
15899928  28 KNVGGIVIINLIAGISSSLVFALLVPYYIS----------------LTKLDVPIYFYSAISLIILTYLLTVTNSIAQGRT 91  Sulfolobus solfatar...
13541485  74 ATNTFFA-VKLVLAVIFVILALSALFFWTDVlhrgfqn--pvefwvIIALIPY-YFFGTLLSIPKSYYSSTFSSYRQVLP 149 Thermoplasma volcanium
16081702  74 ATSTFFA-VKLTLAIIFVIITLSALTIWTDVlhrgfqn--pveywvIIALIPY-YFSGTLLSIPRSYYSSTFSPYRQILP 149 Thermoplasma acidop...
15802517 105 NLKMSRQ-ISGGLTLLAGLSFVITAICYITSgmidwqlvikginenVYAELQHSIKVFVIIFGLGIYSNGVQKVYMGIQK 183 Escherichia coli O1...
13474395 217 LAIVdVAS----AVAGLAVSIAW-TFIDRSYWALFAGTLTGAVLPTLCYWASSRWRPSLPRK-------VAGIGELINFG 284 Mesorhizobium loti
15832096 182 AYIS-NIVna-iFILLSIITLVIsSKLHAGLPVLIVSTLG-IQYISGIYLTINLIIKRLIKFtkvnihaKREAPYLILNG 258 Escherichia coli O1...
2495677  141 TITN-AA------LTILMLEFYQtDLVEKRILAILISNVF-VALLSYLIYRKRVNNKKFYFLq-----yKTAFFYIMSFG 207 Haemophilus influenzae
16273587 144 TVTG-AV------FTVALLEYYQnDLVEKRILAILLSNLV-VWFFSYFLYRKSTTSKKYQFKh-----yQSALFYILGFG 210 Haemophilus influen...
15679468 137 AVLP---------AASEAFALKD--QNLLETYIVQSYRVVTLLVLPMCVG------IAVFSG--------PLLELLFGRD 191 Methanothermobacter...
14286014 141 ASLS-AG------ITVFMLEMYQtELVEKRILAILFSNLL-VFLFAYLLYRQKTRIKSFNFRq-----yKTALYYLLGFG 207 Pasteurella multocida
15899928  92 PKIV--------GISALIFQVLR--LVSGIIFMFIFNLSILAVILAYSIG----YLAQVLFN-------LFFIRANLKID 150 Sulfolobus solfatar...
13541485 150 SIVE-AISrnglFVAIGVIYEYRlFRFPDADLAIVIGSVYSITYTVYYIYMMYLGRPWHLGRp-----nKEMLKYFAIIA 223 Thermoplasma volcanium
16081702 150 SIVE-ALSrngfFIAIGVVYYTHiWKLPDADIAIVIASVYSLTYTVYFLFMMHLGRPWHLQRp-----sVSTFKYFAAVA 223 Thermoplasma acidop...
15802517 184 AYIS-NIVna-iFILLSIITLVIsSKLHAGLPVLIVSTLG-IQYISGIYLTINLIIKRLIKFtkvnihaKREAPYLILNG 260 Escherichia coli O1...
13474395 285 AGITGFNFANFFARNLDNVLIGKYWG--EQQLGLYDrAYKLLLFPLSQITNPLSKVMVPALSRLKDEPDRYR--SAYLRV 360 Mesorhizobium loti
15832096 259 FFFFILQLGTLATWSGDNFIISITLG--VTYVAVFS-ITQRLFQISTVPLTIYNIPLWAAYADAHARNDTQFikKTLRTS 335 Escherichia coli O1...
2495677  208 FLMIFHHGSFFIR-QLDRIFIFHRFS--EAELGLYA-MGAQIAFILSVFILAINKALVPYLFEKLKQGSVKLkdLHRWSL 283 Haemophilus influenzae
16273587 211 LPLILHYASFFLKGQLDRIFIYHKFS--ETDLGLYA-MGAQLALVVSIAIQALNKAIIPYFYEALKQKKLVVqqLHKWAL 287 Haemophilus influen...
15679468 192 FIFGAGALSILVVGMSFYTLFMISSS--IAQGIGYPrLPMYVLVGGTIINLVLNVALVPMLGIEGGALATT----LAALI 265 Methanothermobacter...
14286014 208 LPLIFHNVSLFLRGQLDRIFIYHAFS--EAELGLYA-MGAQIAAIVMILIQVLNKALVPYFFEGLKQQRITLvqVQRWAR 284 Pasteurella multocida
15899928 151 FKVAFSAVRKAVVYIANYIQYILEASivWITLGIVNsDLVVAYFESAIIVSNIQIGHKQYIQGLWLS------------- 217 Sulfolobus solfatar...
13541485 224 LPLAASSGISTINGNIDKIIVQFYWH--ADATSALY-TSQIIGTSLISFSGAISGFFVPVLSRKEKSKDIMYeaPDLERF 300 Thermoplasma volcanium
16081702 224 IPLAATSGIATINGNIDKVIIQFYWH--ADATSALY-TSQILGTALISFSGAITGFFLPILARRQKKIDMTYdsYDLEKY 300 Thermoplasma acidop...
15802517 261 FFFFILQLGTLATWSGDNFIISITLG--VTYVAVFS-ITQRLFQISTVPLTIYNIPLWAAYADAHARNDTQFikKTLRTS 337 Escherichia coli O1...
13474395 361 MPLILLVALPGVAFATAMSDVLIPFVLGEQwraSASIFLALGFAGLLQPLNNPAGWLFVSQGRSGDFMRWGIIT-AVTSV 439 Mesorhizobium loti
15832096 336 LKIVGISSFLLAFILVVFGSEVVNIWTEG----KIQVPRTFIIAYALWSVIDAFSNTFASFLNGLNIVKQQMLAvVT--- 408 Escherichia coli O1...
2495677  284 LSLLIVP---IPSLVTLIVPEQWLLFFLGk--hFIGVKYYIIVFLLSTSLTIPYLFLVNYLFYHGKTKEISFCSvLS--- 355 Haemophilus influenzae
16273587 288 FSFLLIP---IPALIMWIIPEDVLVWILGs--qFVGTKYYFILFLISTTLSIPYLILVNYLFYYGKNKLISQCSvLS--- 359 Haemophilus influen...
15679468 266 IMIIILWKTTQITGVKLPGMAFIRIATASG------VMGGFMILLPQNIPGLLAAIIFAPLVYGLSILLVGGVEk-RDVR 338 Methanothermobacter...
14286014 285 YSLLLVP---IPALIMWFIPEPFVVWLLGs--qFVGTKYYIVLFLIATTLVVPYLILVNYLFYHGQNKSISICSvLT--- 356 Pasteurella multocida
15899928     -------------------------------------------------------------------------------- Sulfolobus solfatar...
13541485 301 ISLFILP---FVIALSVFSVYFLNIFSAGYr-pYYLILVFVALGNYIGIITGPYVSQIIASGKTWNIAKITTPSiIANIA 376 Thermoplasma volcanium
16081702 301 VSLFILP---FVIILAIFSVYFMNIFSAGYr-kYSEILIFVALANYISIITSPFTSAVIASGKTWNIAKITTPSiIANIA 376 Thermoplasma acidop...
15802517 338 LKIVGISSFLLAFILVVFGSEVVNIWTEG----KIQVPRTFIIAYALWSVIDAFSNTFASFLNGLNIVKQQMLAvVT--- 410 Escherichia coli O1...
13474395 440 LAFALGLPYGALGVAIAYaISeYLRTPFLWLYVGKSGPLRASHVLRAATPFVLGAHLALAAVWLIKPMLPQQHVIALASG 519 Mesorhizobium loti
15832096 409 LILIAIPA-KYIIVS-------HFGLTVMLYCFIFIYIVNYFIWYKCSFKKHIDRQLNIRG------------------- 461 Escherichia coli O1...
2495677  356 -TMIYLG--ALGGLI-------FTDVVYIPYASVLGALGILPVLYKITKRVEENEYATH--------------------- 404 Haemophilus influenzae
16273587 360 -TIIYVA--SLVALT-------FTEIKYIPYAGIIGSLSIIPILYFMTSKVSKTL------------------------- 404 Haemophilus influen...
15679468 339 LIRRLGARMGPLSGAVAR------MADLMDRWAR---------------------------------------------- 366 Methanothermobacter...
14286014 357 -TLIYVI--SLLGLT-------LTEIQFVPLASIIGAVSILPVLYWMTAKVGK--------------------------- 399 Pasteurella multocida
15899928     -------------------------------------------------------------------------------- Sulfolobus solfatar...
13541485 377 LNFIFVPP-SLFGYTHLS-MG-YTGTAFASLIVAIGDYIVYKYIYSKNVMHIGYRILRQAIPSFAEILYGYILLMYIHPY 453 Thermoplasma volcanium
16081702 377 LNFVFVPR-SIFGFTGLS-LG-PAGTVFASFLTASADYLIYRYLYYRVEGRNDVSILRQIVPALAEIAVGYAIIRTIKPY 453 Thermoplasma acidop...
15802517 411 LILIAIPA-KYIIVS-------HFGLTVMLYCFIFIYIVNYFIWYKCSFKKHIDRQLNIRG------------------- 463 Escherichia coli O1...
13474395 520 AILAYLITSVVALTFASGREALREAL 545 Mesorhizobium loti
15832096     -------------------------- Escherichia coli O157:H7
2495677      -------------------------- Haemophilus influenzae
16273587     -------------------------- Haemophilus influenzae Rd
15679468     -------------------------- Methanothermobacter thermautotrophicus str. Delta H
14286014     -------------------------- Pasteurella multocida
15899928     -------------------------- Sulfolobus solfataricus
13541485 454 SFFVLLLVSLAAVFIFFGISIAIGEI 479 Thermoplasma volcanium
16081702 454 PFLELLGSSLLLLLVFFLAAIAIGEI 479 Thermoplasma acidophilum
15802517     -------------------------- Escherichia coli O157:H7 EDL933
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap