Conserved Protein Domain Family
RfbX

?
COG2244: RfbX 
Membrane protein involved in the export of O-antigen and teichoic acid [Cell wall/membrane/envelope biogenesis]
Statistics
?
PSSM-Id: 225153
View PSSM: COG2244
Aligned: 113 rows
Threshold Bit Score: 67.8555
Threshold Setting Gi: 15679469
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13474395  73 EGSLRKSVGRGAVVTAMSQSVRVATQIISVIVLSRLLSPQDFGVVAMCAPVLAFIALFQ-DFGLTQATIQKSGIRHEEVN 151
gi 15832096  25 EQERYRIISLSVISSLISKILSLLSLILTVSLTLPYLGQERFG-VWMTITSLGAALTFL-DLGIGNALTNRIAHSFACGK 102
gi 2495677    1 -----MSLIKDSSIYLIGELSAKCVPFLLLPYLSRKLGVEGFGELSYYQTFLPLFVIFI-GLSQDGAVAR----YFYVYG 70
gi 16273587   1 --MIFMKVFKDSVIYLVGELSSKLVPFLLLPYLSRKLGVEGYGSLSYYQTFLSLFLIVV-SLTQEGAISR----YFYFYG 73
gi 15679468   1 ---MEYVVITRAVEQVFMITMAVVFVMAGFYAAGAVIG-TSMGFLASAISAIIIFRRLInSYFPPAPPEKRLGLREELGL 76
gi 14286014   1 -----MKAIKDSAIYLFGELISRSVPFLLLPYLSRKLGVEGFGELSYYQTYLALFLIIV-GLSQEGAIAR----FFYVYG 70
gi 15899928   1 ----------------------------------------------------MYVFTIG-YFTIPANLFSLITSRYSAER 27
gi 13541485   1 ------MFTKKSPILVTQNIINAIAGYIGLFFITRYVGITIWGFVAFGMGFTGIFSLAT-ELGFSSAYTKSISEGKDVEE 73
gi 16081702   1 ------MLSRKSPIIVTANIINAIAGYLGLFFITRYVGITIWGFVAFGMGFTGIFSLAT-ELGFSSAYTKSVSEGYDVRD 73
gi 15802517  27 EQERYRIISLSVISSLISKILSLLSLILTVSLTLPYLGQERFG-VWMTITSLGAALTFL-DLGIGNALTNRIAHSFACGK 104
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13474395 152 YLFWINVAVSAILACVLAGAAPLVAAFYGEP---------------RVAGLVAAFGLQIMAYGLGAQHLALLTRRMQFGR 216
gi 15832096 103 NLKMSRQ-ISGGLTLLAGLSFVITAICYITSgmidwqlvikginenVYAELQHSIKVFVIIFGLGIYSNGVQKVYMGIQK 181
gi 2495677   71 KRSLNLV-VKTGYAYTLSIGGLGLLFCWLmqsei--------mfylVLSAIFQ-VFLSVQLSIRQCQKQAIPYTFIQVSS 140
gi 16273587  74 KRSLNLV-VNTGYAYTTIIGSIILIGCWIaqsei--------lfyaALSSIFQ-SFLNVQLSVRQCQKKAWSYAFIQFSL 143
gi 15679468  77 VKTLISFSIPVIITALSEMAIYDISVFVIG-------------------Y-FMATTSVGYYTAADPVARLPLVISMSVAT 136
gi 14286014  71 KRALNLV-VNAGYAYTLSIGSVILAFCLFfkaem--------laylALSAIFQ-SFLAVQLSVRQCQKQAVAYSVIQFLS 140
gi 15899928  28 KNVGGIVIINLIAGISSSLVFALLVPYYIS----------------LTKLDVPIYFYSAISLIILTYLLTVTNSIAQGRT 91
gi 13541485  74 ATNTFFA-VKLVLAVIFVILALSALFFWTDVlhrgfqn--pvefwvIIALIPY-YFFGTLLSIPKSYYSSTFSSYRQVLP 149
gi 16081702  74 ATSTFFA-VKLTLAIIFVIITLSALTIWTDVlhrgfqn--pveywvIIALIPY-YFSGTLLSIPRSYYSSTFSPYRQILP 149
gi 15802517 105 NLKMSRQ-ISGGLTLLAGLSFVITAICYITSgmidwqlvikginenVYAELQHSIKVFVIIFGLGIYSNGVQKVYMGIQK 183
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13474395 217 LAIVdVAS----AVAGLAVSIAW-TFIDRSYWALFAGTLTGAVLPTLCYWASSRWRPSLPRK-------VAGIGELINFG 284
gi 15832096 182 AYIS-NIVna-iFILLSIITLVIsSKLHAGLPVLIVSTLG-IQYISGIYLTINLIIKRLIKFtkvnihaKREAPYLILNG 258
gi 2495677  141 TITN-AA------LTILMLEFYQtDLVEKRILAILISNVF-VALLSYLIYRKRVNNKKFYFLq-----yKTAFFYIMSFG 207
gi 16273587 144 TVTG-AV------FTVALLEYYQnDLVEKRILAILLSNLV-VWFFSYFLYRKSTTSKKYQFKh-----yQSALFYILGFG 210
gi 15679468 137 AVLP---------AASEAFALKD--QNLLETYIVQSYRVVTLLVLPMCVG------IAVFSG--------PLLELLFGRD 191
gi 14286014 141 ASLS-AG------ITVFMLEMYQtELVEKRILAILFSNLL-VFLFAYLLYRQKTRIKSFNFRq-----yKTALYYLLGFG 207
gi 15899928  92 PKIV--------GISALIFQVLR--LVSGIIFMFIFNLSILAVILAYSIG----YLAQVLFN-------LFFIRANLKID 150
gi 13541485 150 SIVE-AISrnglFVAIGVIYEYRlFRFPDADLAIVIGSVYSITYTVYYIYMMYLGRPWHLGRp-----nKEMLKYFAIIA 223
gi 16081702 150 SIVE-ALSrngfFIAIGVVYYTHiWKLPDADIAIVIASVYSLTYTVYFLFMMHLGRPWHLQRp-----sVSTFKYFAAVA 223
gi 15802517 184 AYIS-NIVna-iFILLSIITLVIsSKLHAGLPVLIVSTLG-IQYISGIYLTINLIIKRLIKFtkvnihaKREAPYLILNG 260
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13474395 285 AGITGFNFANFFARNLDNVLIGKYWG--EQQLGLYDrAYKLLLFPLSQITNPLSKVMVPALSRLKDEPDRYR--SAYLRV 360
gi 15832096 259 FFFFILQLGTLATWSGDNFIISITLG--VTYVAVFS-ITQRLFQISTVPLTIYNIPLWAAYADAHARNDTQFikKTLRTS 335
gi 2495677  208 FLMIFHHGSFFIR-QLDRIFIFHRFS--EAELGLYA-MGAQIAFILSVFILAINKALVPYLFEKLKQGSVKLkdLHRWSL 283
gi 16273587 211 LPLILHYASFFLKGQLDRIFIYHKFS--ETDLGLYA-MGAQLALVVSIAIQALNKAIIPYFYEALKQKKLVVqqLHKWAL 287
gi 15679468 192 FIFGAGALSILVVGMSFYTLFMISSS--IAQGIGYPrLPMYVLVGGTIINLVLNVALVPMLGIEGGALATT----LAALI 265
gi 14286014 208 LPLIFHNVSLFLRGQLDRIFIYHAFS--EAELGLYA-MGAQIAAIVMILIQVLNKALVPYFFEGLKQQRITLvqVQRWAR 284
gi 15899928 151 FKVAFSAVRKAVVYIANYIQYILEASivWITLGIVNsDLVVAYFESAIIVSNIQIGHKQYIQGLWLS------------- 217
gi 13541485 224 LPLAASSGISTINGNIDKIIVQFYWH--ADATSALY-TSQIIGTSLISFSGAISGFFVPVLSRKEKSKDIMYeaPDLERF 300
gi 16081702 224 IPLAATSGIATINGNIDKVIIQFYWH--ADATSALY-TSQILGTALISFSGAITGFFLPILARRQKKIDMTYdsYDLEKY 300
gi 15802517 261 FFFFILQLGTLATWSGDNFIISITLG--VTYVAVFS-ITQRLFQISTVPLTIYNIPLWAAYADAHARNDTQFikKTLRTS 337
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13474395 361 MPLILLVALPGVAFATAMSDVLIPFVLGEQwraSASIFLALGFAGLLQPLNNPAGWLFVSQGRSGDFMRWGIIT-AVTSV 439
gi 15832096 336 LKIVGISSFLLAFILVVFGSEVVNIWTEG----KIQVPRTFIIAYALWSVIDAFSNTFASFLNGLNIVKQQMLAvVT--- 408
gi 2495677  284 LSLLIVP---IPSLVTLIVPEQWLLFFLGk--hFIGVKYYIIVFLLSTSLTIPYLFLVNYLFYHGKTKEISFCSvLS--- 355
gi 16273587 288 FSFLLIP---IPALIMWIIPEDVLVWILGs--qFVGTKYYFILFLISTTLSIPYLILVNYLFYYGKNKLISQCSvLS--- 359
gi 15679468 266 IMIIILWKTTQITGVKLPGMAFIRIATASG------VMGGFMILLPQNIPGLLAAIIFAPLVYGLSILLVGGVEk-RDVR 338
gi 14286014 285 YSLLLVP---IPALIMWFIPEPFVVWLLGs--qFVGTKYYIVLFLIATTLVVPYLILVNYLFYHGQNKSISICSvLT--- 356
gi 15899928     --------------------------------------------------------------------------------
gi 13541485 301 ISLFILP---FVIALSVFSVYFLNIFSAGYr-pYYLILVFVALGNYIGIITGPYVSQIIASGKTWNIAKITTPSiIANIA 376
gi 16081702 301 VSLFILP---FVIILAIFSVYFMNIFSAGYr-kYSEILIFVALANYISIITSPFTSAVIASGKTWNIAKITTPSiIANIA 376
gi 15802517 338 LKIVGISSFLLAFILVVFGSEVVNIWTEG----KIQVPRTFIIAYALWSVIDAFSNTFASFLNGLNIVKQQMLAvVT--- 410
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13474395 440 LAFALGLPYGALGVAIAYaISeYLRTPFLWLYVGKSGPLRASHVLRAATPFVLGAHLALAAVWLIKPMLPQQHVIALASG 519
gi 15832096 409 LILIAIPA-KYIIVS-------HFGLTVMLYCFIFIYIVNYFIWYKCSFKKHIDRQLNIRG------------------- 461
gi 2495677  356 -TMIYLG--ALGGLI-------FTDVVYIPYASVLGALGILPVLYKITKRVEENEYATH--------------------- 404
gi 16273587 360 -TIIYVA--SLVALT-------FTEIKYIPYAGIIGSLSIIPILYFMTSKVSKTL------------------------- 404
gi 15679468 339 LIRRLGARMGPLSGAVAR------MADLMDRWAR---------------------------------------------- 366
gi 14286014 357 -TLIYVI--SLLGLT-------LTEIQFVPLASIIGAVSILPVLYWMTAKVGK--------------------------- 399
gi 15899928     --------------------------------------------------------------------------------
gi 13541485 377 LNFIFVPP-SLFGYTHLS-MG-YTGTAFASLIVAIGDYIVYKYIYSKNVMHIGYRILRQAIPSFAEILYGYILLMYIHPY 453
gi 16081702 377 LNFVFVPR-SIFGFTGLS-LG-PAGTVFASFLTASADYLIYRYLYYRVEGRNDVSILRQIVPALAEIAVGYAIIRTIKPY 453
gi 15802517 411 LILIAIPA-KYIIVS-------HFGLTVMLYCFIFIYIVNYFIWYKCSFKKHIDRQLNIRG------------------- 463
                       490       500
                ....*....|....*....|....*.
gi 13474395 520 AILAYLITSVVALTFASGREALREAL 545
gi 15832096     --------------------------
gi 2495677      --------------------------
gi 16273587     --------------------------
gi 15679468     --------------------------
gi 14286014     --------------------------
gi 15899928     --------------------------
gi 13541485 454 SFFVLLLVSLAAVFIFFGISIAIGEI 479
gi 16081702 454 PFLELLGSSLLLLLVFFLAAIAIGEI 479
gi 15802517     --------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap