Conserved Protein Domain Family
NagE

?
COG2190: NagE 
Click on image for an interactive view with Cn3D
Phosphotransferase system IIA component [Carbohydrate transport and metabolism]
linked to 3D-structure
Statistics
?
PSSM-Id: 225101
View PSSM: COG2190
Aligned: 58 rows
Threshold Bit Score: 98.0524
Threshold Setting Gi: 16081064
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1AX3          8 NEIGEEVFVSPITGEIHPITDVPDQVFSGKMMGDGFAILPSEGIVVSPVRG--KILNVFPTKHAIGLQSDGGREILIHFG 85
gi 1730951   16 T---EEVIYSPADGTVMDLSDVPDPVFSQKMMGEGIAVEPSSGEIVSPAEG--EVIQIFHTKHAVGIRTRSGIELLIHVG 90
gi 16081064   1 --------------------------------------------------------MVTPTKHAIGLRSASGVELLAHIG 24
gi 15893714 471 kveevESVVSPVNGKVVLLKNVPDKTFAEGLIGDGIGVDPEDGEVVSPIDG--TVVHVFETKHAIAMKSKNGVEMLIHIG 548
gi 15896668  13 V----ESVFAYASGKLLNIEDVPDPIFSEKSMGEGVAILPSDGRIVAPVDG--EIILIAPTKHALALKTTLGQEILIHIG 86
gi 19704250  10 KEKTIVTIYSPINGKVIELKEVPDEAFAQKMVGDGCAIEPDKGIICSPIDG--QLMNIFPTNHAIIFETIDGLEMIVHFG 87
gi 1346893  739 KVQDEIVILSPVNGTLKPLTQVPDDTFKNRLVGDGIAILPSDGHFKAPGDVgvKTELAFPTGHAFIFDVD-GVKVMLHIG 817
gi 15927003  17 A------IYAPLTGEYVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIAG--RVDNVFPTKHAIGLKADNGLELLVHIG 88
gi 15925528 537 ealgtTDIYAPGVGQIIPLSEVPDQVFAGKMMGDGIGFIPEKGEIVAPFDG--TVKTIFPTKHAIGLESESGVEVLIHIG 614
gi 16800085   7 kksknETVFAHVTGQLIALEDVPDPVFNQKMMGEGIAIKPESGTIVAPVDG--KIIQLAETKHAFGIRTDMGQEILVHIG 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1AX3         86 IDTVSLK-----GE---GFTSFVSEGDRVE-PGQKLLEVDLDAVKPNVPSLMTPIVFTN--LAEGETVSIKASGSVNREQ 154
gi 1730951   91 LETVNMN-----GE---GFTAHIKEGDKVK-VGDPLITCDLELIKEKASSTVIPIVIMN--GEAVGSMVSAGEKAARKGE 159
gi 16081064  25 LDTVTFD-----GT---PFSLKVKEGDTVK-KGEVLVEFDKAFIEDIEESALHQKIFTVv-S------------------ 76
gi 15893714 549 IDTVKME-----GN---GFKSFINDGEEVK-KGDKLIQFDLDLVKEKAVSPIVLTIVTNh-EDMGFVNSEKIDGKQLRQK 618
gi 15896668  87 LETVMLN-----GQ---GIELLIGLGDKVV-AGQNIANIDLDFIKKNASSTVIPMVITNs-EEDLFDFEWEDVNEVSAGE 156
gi 19704250  88 IDTVKLD-----GK---GFQKLREPG-PIK-IGDEIVKYNLDEIKDGVPSTRSPIIINNm-EKVEKIEILSLGKVVKIGE 156
gi 1346893  818 IDTVKINadkkpGEqleVFDVKTKQGEYTKlKSESVVEVDLKKLKRK-YDPITPFIVMQesLDNFKLVPIRQRGEIKVGQ 896
gi 15927003  89 LDTVQLD-----GE---GFEVLVSSGDEVN-VGDPLVRFNLEFINNNAKSVISPIIITN--TDQAASINIYDENAVIKGE 157
gi 15925528 615 IDTVKLN-----GE---GFESLINVDEKVT-QAQPLMKVNLAYLKAHAPSIVTPMIITNl-ENKELVIEDVQDADPGK-- 682
gi 16800085  85 LETVSLN-----GE---GFNVLVNVGDKVK-VGDPIVEADFDFIKKNAASTVVPMVVTNs-SEGKYDFEFAGTPNTVAGK 154

                ....*...
1AX3        155 EDIVKIEK 162
gi 1730951  160 SKLFTIKA 167
gi 16081064     --------
gi 15893714 619 DEILKIGI 626
gi 15896668 157 TKIFKASC 164
gi 19704250 157 PIMKVTLK 164
gi 1346893  897 PLFKLIYK 904
gi 15927003 158 TKVIDVTM 165
gi 15925528 683 ---LIMTV 687
gi 16800085 155 TEVFTTNL 162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap