Conserved Protein Domain Family
YhiN

?
COG2081: YhiN 
Predicted flavoprotein YhiN [General function prediction only]
Statistics
?
PSSM-Id: 224992
View PSSM: COG2081
Aligned: 31 rows
Threshold Bit Score: 429.7
Threshold Setting Gi: 16080058
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15890928  48 SEARQVAIIGGGPAGLMAAEMLSAAGHAVTVFEAMPTVARKLLMAGKSGLNITHAED-YDSFRHRFGEAEPRLRAALDNF 126
gi 17987229   1 MRRDRIAIVGGGPAGLIAAERLSASGHQVTLYEQMPTVGRKFMLAGKSGLNITHSEK-FVTFAARYGASRDRILPALDGF 79
gi 15895124   1 ---------------MMAAITAAK-KHEVILIERNEKLGKKLFITGKGRCNITNSIS-IDEFFENIPGNPYFLYSSLYSF 63
gi 15896824   1 ---MKVIVIGGGASGIMAAISAKDLGYEVSILERNDRIGKKILTTGNGRCNITNENIiTKRYHSNNP---NFFEHVINEF 74
gi 15672240   5 AKTFDVIVVGAGPSGMMAAISAAQNGAKVALIDKNKKVGKKLLMTGGGRCNVTNARS-VDEILTNVPGNGRFLHSAFSQF 83
gi 15599144   1 ----------------MAAEVLSQAGVRTEVFDAMPSVGRKFLLAGVGGMNITHAEA-REQFLGRYGRRQKEIAALLGEF 63
gi 17547877   5 HNAPLVAVIGAGPAGLMAAEVLSRAGVRVEVFDSMPSAGRKFLLAGIGGMNITHSEA-FDAFLGRYRARREQLAPLIDRF 83
gi 16264053   1 MERKEIAIIGGGPAGLMAAEVLSRSDHAVTVYEAMPTAARKFLLAGKSGLNITHSED-YRDFATRFGDASARLRPGLDAF 79
gi 15900636   1 MKHFDTIVIGGGPAGMMATISSSFYGQKTLLIEKNRKLGKKLAGTGGGRCNVTNNGS-LDNLLAGIPGNGRFLYSVFSQF 79
gi 15675685   1 MTQYDTIIIGGGPAGMMAAISSSYYGYKTLLIEKNRRLGKKLAGTGGGRCNVTNSGN-LDVLMAGIPGNGRFLYSVFSQF 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15890928 127 TPEMLRDWAERLGQETFVGTSGRVFPRVMKASPLLRAWLARLEAQGVTIQTRHRWTGFSGD---RLVFATPGGEv----- 198
gi 17987229  80 GPESLRQWADDLGAETFIGSSGRVFPKAMKASPLLRAWLKRLEAQGVQILTRHRWIGFDDG---ALLIETPAGPa----- 151
gi 15895124  64 TNNDLMDFIEGLGVKLKVERGGRVFPKSDKSSDIILALERELKKRNVKVILNSRVVSIKLEngvIKSVTTSNNE------ 137
gi 15896824  75 TAENTISFFEMLGLPLISLEGGKMYPLSLQASSVLDILRIALDERDIEVITNSKITKIIRNk-sSFKIISSDGA------ 147
gi 15672240  84 SNLDIIEFFESNGVKLKEEDHGRMFPITDKSKTIVDALFNKILSLHVSYFPSQAVDKLLIEngaVIGLETDSES------ 157
gi 15599144  64 DADALRAWIHGLGIDTFVGSSGRVFPSDMKAAPLLRAWLKRLREQGVLIHTRCRWLGWNAD----GTLDIQSAAer---- 135
gi 17547877  84 SPDALRDWVHGLGIETFIGSSGRVFPTDMKAAPLLRAWLHRLREAGVKLHMRHRWAGWSAAp--SGQADQPEALrfetpd 161
gi 16264053  80 TPRDVRVWAAGLDAETFVGSSGRVFPKAMKASPLLRAWLRRLEAQGVRLLTRHRWSGFAEN---GYIFDTPEGKt----- 151
gi 15900636  80 DNHDIINFFTENGVKLKVEDHGRVFPASDKSRTIIEALEKKITELGGQVATQIEIVSVKKVd-dQFVLKSADQT------ 152
gi 15675685  80 DNHDIIAFFEENGVKLKEEDHGRMFPTTDKSRTIIDALEKKIKALGGQVLTSTEVVSVKKQd-dLFYLKSADQT------ 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15890928 199 ---TIKADAALLALGGASWPRLGSDAAWVPVLAQKGVEVSPFRPANCGFDVD-WSDIfrERFAGEAVKSTVTISPAG--- 271
gi 17987229 152 ---RVEYDSALFALGGVSWPKLGSDAAWVAPFKAKGIEVSRLRPANCGFDVD-WSDYfrNRFAGEPVKSVAMTTAAG--- 224
gi 15895124 138 ---CFKGDFFILCTGGKSYPQTGSTGDGYNFARDMGHNIVEPRPSLVPIEIR-ESFI--SDLQGLSLKNVSLYIKKGkk- 210
gi 15896824 148 ---EYFADKVILAAGGMSAPKTGSDGLGMTLAASLGHRLIKTVPALVQLKLDfKSL---RALSGIKFDGNIKILVDGe-- 219
gi 15672240 158 ----FLSPTIILSTGGRAYPSTGSTGDGYRLARSAGHSISQLYATESALISD-EPFIldKSLQGISLREIKLSVLNSkgk 232
gi 15599144 136 --lSIRADAVILALGGGSWQRLGSDGAWVPLLRARGIEVEPLRPSNCGFEIDgWSELfrDKFSGAPVKPVAMGLAGe--- 210
gi 17547877 162 gerlVHADAVVLAMGGGSWPRLGSDGAWVPRLEARGVQVLPLKPANCGFDAD-WSAHfrERFAGQPVKSVAIGVASGdd- 239
gi 16264053 152 ---VVRCDAALLALGGASWPRLGSDAAWMPLLRARGVPISDFRPANCGFDVA-WSEIfrERFAGQPLKGVTATSDAG--- 224
gi 15900636 153 ----FTCEKLIVTTGGKSYPSTGSTGFGHEIARHFKHTITDLEAAESPLLTD-FPh---KALQGISLDDVTLSygk---- 220
gi 15675685 153 ----FTCQKLIVTTGGKSYPSTGSTGFGHDIARHFKLTVTDLEAAESPLLTD-FPh---KVLQGISLDDVTLSydk---- 220
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15890928 272 ---AFQ---GEFVITKHGIEGSVIYAHSAALR--DrLEQAGGAALAVDLAPGRTVERLCRDL---EKLGRKESFANRMRK 340
gi 17987229 225 ---TSQ---GEFVITRIGIEGSLVYAHSAALR--DdLEKKGEASIILDLAPGRALERLKSDL---ARQNGKLSFSNLLRK 293
gi 15895124 211 --vLYDn-fGEMLFTHYGISGPIVLSASRVVN------YNNDLKAVIDLKPALDEKELDKRIqkdFMKYINKDFKNALDD 281
gi 15896824 220 ---EKRcefGEILFTDYGISGPPILQLSRIAS--YaVEEKKEVKIEVDMLPHYSRDSLKAFLenhWGTFSYRSVYDSFIG 294
gi 15672240 233 aiiSHQ---HDLLFTHFGISGPAAMRCSSFINqlLaKGEK-MVTVSLDQFPEKKLGSLKNELtslSKT--DKSIKNAFSG 306
gi 15599144 211 --tPRQ---GEFVVTRDGIEGSLVYALSAAIR--ErIEARGSAEVWLDLLPNRRREQIEAAL---ARPRGSRSMANHLRS 280
gi 17547877 240 --gARQfrpGEFLVTQSGIEGSLVYALSAPIR--DaLEAGGEITIWLDLAPGWSAQRVADAL---MRPRGARSMSSHLQS 312
gi 16264053 225 ---TVS---GEFVVTRHGIEGSLVYAHAASLR--DrLDRDGTAALLLDLTPGRTAGRLARDL---ARQDRKASFSNRLRK 293
gi 15900636 221 hviTH-----DLLFTHFGLSGPAALRMSSFVK-----GGE---VLSLDVLPQLSEK----DLvtfLEENREKSLKNALKT 283
gi 15675685 221 hviTH-----DLLFTHFGLSGPAALRLSSFVK-----GGE---IAELDFLPHLSTD----DLtayLSDQRDKNIKNALKG 283
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15890928 341 AAGLSAVKVGLLR-------EIFPDIAAMPDGFVAARLKHLEIPLLRPRPIAEAISAAGGVAWSGVDEN-YMLESIPGIF 412
gi 17987229 294 GAGLTGVKAALLW-------EIQREKD---PEKLARTIKALPVAVVRPRPIEEAISSAGGICWNEIDNR-YMLRKMPGIF 362
gi 15895124 282 LLPQKLIPVIIKLski-eedKKVNLITKEERKKIVNLIKEFTITIKGLRPITEAIITAGGVDVKEIDPStLKSKKVSNLY 360
gi 15896824 295 IINKKMIPILLKQcgiidihKYCFDLTWEEKENIFNYLKCWSFKVCGTNSYSNSQVTAGGVDTVEVNNItLESKLVPGLY 374
gi 15672240 307 LTQERMLLFILEKagi-dpsLSAKTLSEQQIDKIASLFKNWQITISKTLPIEKSFVTGGGVSLKEINPKsMESKQTQGLF 385
gi 15599144 281 QLGIDGVRAGLLR-------ELTPAATYTEPARLAAAIKRLPLTLLRPRPLDEAISSAGGVRFEALDRN-LMLDGLPGVF 352
gi 17547877 313 KLNITGVKLGLLR-------ECLSKDAFADLAQLAQAIKALPLRLTRARPIDEAISSAGGVAFEALDAN-LMIARLPGVF 384
gi 16264053 294 GAGLDPVKAALLR-------ELSPEAARAAAEQLAAEIKALPLPVLATRPIAEAISSAGGIRLDAIDDR-YMLKALPGLF 365
gi 15900636 284 LLPERLAEFFVQGy-----pEKVKQLTEKEREQLVQSIKELKIPVTGKMSLAKSFVTKGGVSLKEINPKtLESKLVPGLH 358
gi 15675685 284 LLPERVADFLSEDy-----pEKVKQLSPKQEKELLDKLKHLQIPITGKMSLAKSFVTKGGVDLKEINPKtLESKKVPGLY 358
                       410       420       430
                ....*....|....*....|....*....|....*.
gi 15890928 413 VAGEMLDWEAPTGGYLLTACFATGKAAAKGLAGWLE 448
gi 17987229 363 VAGEMIDWEAPTGGYLLTACFAMGVAAAEGIIDWLQ 398
gi 15895124 361 FCGEIVDVDAYTGGFNLQIAMSTAHEAGRNIGD--- 393
gi 15896824 375 FCGEVLDVDGDCGGFNLQWAWSSGYIAGKCL----- 405
gi 15672240 386 MTGELLDINGYTGGYNITCAFVTGFVAGKHAAQIAS 421
gi 15599144 353 CAGEMLDWEAPTGGYLLTACFASGRVAGLGALAWLR 388
gi 17547877 385 CAGEMLDWEAPTGGYLLTACFASGAAAGHGVLAYLA 420
gi 16264053 366 AAGEMLDWEAPTGGYLLTACLAMGRAAARGVEAWLA 401
gi 15900636 359 FAGEVMDINAHTGGFNITSALCTGWVAGSLHYD--- 391
gi 15675685 359 FAGEVLDINAHTGGFNITSALCSGWIAGKSS----- 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap