Conserved Protein Domain Family
MetP

?
COG2011: MetP 
ABC-type methionine transport system, permease component [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 224922
View PSSM: COG2011
Aligned: 39 rows
Threshold Bit Score: 171.595
Threshold Setting Gi: 15612550
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15792111  34 SSITSFNENYENILKPALNETIYMSLMAVLFGFLLAIIPGILLAIWDKNGIKENKIAYSILDFITNILRAFPFLILIVVL 113 Campylobacter jejuni
15616042   3 E------NFKWDALWEATKETIYMTSVSVVATFVIGIILGLILFLTSKGNMWQNVAIHTVFSAIVNIFRSIPFIILIVLL 76  Bacillus halodurans
16080326   3 EKYF--PNVDLTELWNATYETLYMTLISLLFAFVIGVILGLLLFLTSKGSLWQNKAVNSVIAAVVNIFRSIPFLILIILL 80  Bacillus subtilis
1175504    1 ---------MWGVVATATYETVYISFASTLLAVLVGVPVGIWTFLTGKNEILQNNRTHFVLNTIINIGRSIPFIILLLIL 71  Haemophilus influenzae
15672305  10 PNVVYLGWSGETGWWTAIVQTLYMTFISALIGGLLGLIFGIGVVVTAEDGITPNRPLFWILDKIVSIGRAFPFIILLAAI 89  Lactococcus lactis ...
15603594   8 DFTQEMTPRIWELVGLSTLETLYMGFIATLFAIVIGLPIGLLAFLTGKGEILENRRANQVLNVIINIGRSVPFIILLIIL 87  Pasteurella multocida
15926498  10 NEMITMPNIQWPEVWTAIVETLYMTVVSTIFAFILGLILGVLLFLSAKGKSIGARLFYSIVSFIVNLFRAIPFIILILLL 89  Staphylococcus aure...
15900090  10 PNVYKMGWAGQAGWGTAIYLTLYMTVLSFIIGGFLGLVAGLFLVLTAPGGVLENKVVFWILDKITSIFRAVPFIILLAIL 89  Streptococcus pneum...
15674485   1 -MFMNSDGHGDAGWGLAIWNTLYMTIVPFIVGGAIGLLLGLLLVLTGPDGVIENKTICWVIDKVTSIFRAIPFVILIAIL 79  Streptococcus pyoge...
16801575   5 QELF--PNVDFQMMWVATQETLYMTLTSLFAVFLLGIVLGLLLFLTNNKKHAGARILYWITAILVNVFRSIPFIILIVLL 82  Listeria innocua
15792111 114 LPLSKIIVGTSIGTNAAIVPLAIGIAPYLAKMLESAFKEIDKGIIEAAKSYGASNIQIIFKVIFSEALPAIISGITLTLI 193 Campylobacter jejuni
15616042  77 IPFTRALFGSMLGANAALPALIIGAAPFYARMVEIALREIDKGVIEAAQAMGAGHFRIICRVLIPESFPALISGITVTAI 156 Bacillus halodurans
16080326  81 LGFTKFLVGTILGPNAALPALVIGSAPFYARLVEIALREVDKGVIEAAKSMGAKTSTIIFKVLIPESMPALISGITVTAI 160 Bacillus subtilis
1175504   72 LPVTRFIVGTVLGTTAAIIPLSICAMPFVARLTANALMEIPNGLTEAAQAMGATKWQIVRKFYLSEALPTLINGVTLTLV 151 Haemophilus influenzae
15672305  90 APLTKILVGTQIGVTAALVPLALGVAPFYARQVQASLESVDHGKVEAAQTVGADFLDIVFTVYLREELASLIRVSTVTLI 169 Lactococcus lactis ...
15603594  88 LPFTRLVVGTTLGTTAAIVPLSVSAIPFFARLTANALLEIPSGLTEAAKSMGATNWQIVTKYYLPESIPILINGITLTLV 167 Pasteurella multocida
15926498  90 IPFTSLILGTISGPTGALPALIIGAAPFYARLVEIAFKEIDKGVIEAAWSMGANTWIVIRKVLLPEAMPALVSGITVTAI 169 Staphylococcus aure...
15900090  90 SPLSHLIVKTSIGPNAALVPLSFAVFAFFARQVQVVLAELDGGVIEAAQASGATFWDIVG-VYLSEGLPDLIRVTTVTLI 168 Streptococcus pneum...
15674485  80 ASFTYLLLRTTLGATAALVPLTFATFPFYARQVQVVFSELDKGVIEAAQASGATFWDIVK-VYLSEGLPDLIRVSTVTLI 158 Streptococcus pyoge...
16801575  83 LPMTKSLVGTVIGPKAALPALIISAAPFYGRMVEIAFREVDKGVIEAAKSMGANMFTIIGKVLIPEALPAIISGITVTAI 162 Listeria innocua
15792111 194 FTIGFSALAGTVGGGGLGDVAIRYGYERFNKEVMIQTVVILLILVQLVQILGNL--FYTWAKNS 255 Campylobacter jejuni
15616042 157 ALVSYTAMAGVIGAGGLGHFAFLEGFQRNNPEITLVATITILFLVFIIQWIGDF--FTNITDKR 218 Bacillus halodurans
16080326 161 ALIGSTAIAGAIGSGGLGNLAYVEGYQSNNADVTFVATVFILIIVFIIQIIGDL--ITNIIDKR 222 Bacillus subtilis
1175504  152 TLVGYSAMAGTQGGGGLGSLAINYG--R----ISQYA------LCNLG---GNHyyCAIRYD-- 198 Haemophilus influenzae
15672305 170 SLIGLTAMAGAIGAGGLGNTAISYGYNRFANDVTWFATILILIFVLLVQLVGDF--LARRVSHR 231 Lactococcus lactis subsp. lactis
15603594 168 ALIGYSAMAGAVGGGGLGNLAITYGEHRNMIYVKWIATIIIVLIVMLSQKLGDH--LAERFDHR 229 Pasteurella multocida
15926498 170 ALVGSTAVAGVIGAGGLGNLAYLTGFTRNQNDVILVSTVFILIIVFIIQFIGDW--LTNKLDKR 231 Staphylococcus aureus subsp. aureus...
15900090 169 SLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDVTILATIIIILIIFAIQFLGDF--LTKKLSHK 230 Streptococcus pneumoniae TIGR4
15674485 159 SLVGETAMAGAIGAGGLGNVAISYGYNRFNNDVTWVATIIILLIIFAIQFIGDS--LTRRFSHK 220 Streptococcus pyogenes M1 GAS
16801575 163 SLVGFTAMAGVIGAGGLGNTAYLEGFQRGQPDVTVLATIIILIIVFIFQFIGDF--LTKRTDKR 224 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap