Conserved Protein Domain Family
COG1829

?
COG1829: COG1829 
Archaeal pantoate kinase [Coenzyme transport and metabolism]
Statistics
?
PSSM-Id: 224742
View PSSM: COG1829
Aligned: 11 rows
Threshold Bit Score: 190.293
Threshold Setting Gi: 15789544
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20090143  25 FIAKAYAPGHITGFFQIHEHNDPH--RKGSTGCGIVLNGGVTTEVKAGKSve-kTEIFLNG---KKVEGRTTRTVVEMLT 98  Methanosarcina acet...
11499236   1 ---MIFAPASITCIFSPHVDSNPK--NSGSIGVGFTIERG----LQASPS----RKTTING---EEWNFPTLDDVLEKVG 64  Archaeoglobus fulgidus
14601727  20 VARCLSTPHHITALFRPVPGPGPG--YSGSIGVGLAVEPR----ARFCPG----LDGWEPG-----YDLPQFNEAAELLG 84  Aeropyrum pernix
3024949    1 ----MFAPGHITGFFVICKSSNKL--KTGSIGAGITIDRGVNVELKEGNG-----SIFYNN---KKVNICAVEKVIEHYK 66  Methanocaldococcus ...
20094170   1 --MKLSVPGALTGFFHPQPGKTPK--DTGSPGFGLAVDSVVIVRVRRLRAe--rLRVRADH----PIDSRIARKCYEVLD 70  Methanopyrus kandle...
15678605   8 MKPRVFVPAHITGFFEVVMQRDPL--RSGSRGAGVVLDRGVKTGVKLRGSdd-tTKVRVNG---RRDDDGVSIRAVEILR 81  Methanothermobacter...
14520599   1 MLVRAFVPAHITAFFVPIIRDDPQ--LSGSLGAGVNLSRGTNVFISFEESlerhVHVALNGepvKREDAKVTFHVIDKML 78  Pyrococcus abyssi
18314043   1 MAKRLFIPHHISGFWLPVYTDDPV--TTGSVGAGVLVGGA----VAVYEG----VGVRYND---------------ALLE 55  Pyrobaculum aerophilum
14591577   1 MLIRAFVPAHITAFFVPIIREDPQ--NSGSLGAGINLSKGTNVFISFEESlekhVHVAFNGepvKKEDARITYHVIEKIL 78  Pyrococcus horikoshii
15899149  21 LGVEIKVPISISGIWYPVIEKENLi-KSGSIGLTLTLEPYITAEIRNGSG------IEFNG---IEIQLPNYEILKKKLG 90  Sulfolobus solfatar...
15789544   5 ESAVAFAPGHVTGFFSVDTGATEAavASGSRGAGVALSAGVTVTVTRAEN----TGVVLNG---TPTEIASVRGVLDALG 77  Halobacterium sp. N...
20090143  99 DVP-----VKVKSWAEIPVGCGFGASGAGALGAAYALNRVLSLNqtVKSLTEYAHVAEVVNRSGLGDIAAQSNGG-VVIR 172 Methanosarcina acet...
11499236  65 LEG-------VEIKASLPFGCGFGMSGAAALAT--AVLGNLGY----IEAADIAHVAEVENFTGLGDVVTQTFGG-VVVR 130 Archaeoglobus fulgidus
14601727  85 SRP------GGRLVYPLPPGRGYAVSAASAILGALAAAMERGAG--VFRAYRAAHEVEVRRSTGLGDVASIACGVgLVLR 156 Aeropyrum pernix
3024949   67 KFGyn-ddYDIIFSSDFPLGSGLGMSGGCALILAKKLNEMLNLN---ENYAEIAHISEVECGTGLGDVIAQYVKG-FVIR 141 Methanocaldococcus ...
20094170  71 PDGg----LSVRYEFSVPPGCGLGTSAASALGTLAAGAAEIGLEvsPEWIARRAYEIELELGTGIGDVVTIWHGG-AVLR 145 Methanopyrus kandle...
15678605  82 ELTgfsegVSIHHEVEVPIGCGFGTSAACALGSVLAIASELELPitFNMAGEVAHRAEVELGTGLGDLIAEVTGG-MVIR 160 Methanothermobacter...
14520599  79 PQEyv-geVEVWQYFDYPTGHGFGNSGGGALGTALCLAYKFRRt--LLSAAKVAHEAEVLNRGGLGDIVAQLAGG-VEVR 154 Pyrococcus abyssi
18314043  56 RDG------GVKIASPFPLGYGYAASAVVAIAKAIGEAGLAPR------AFVKAHVEEVSRRTGLGDVLAIYTGGcLVAR 123 Pyrobaculum aerophilum
14591577  79 PEDyi-geVEVWQYFDYPTGHGYGNSAGGALGTALGLSYKFGGt--LLSASRIAHEAEVIHKGGLGDIVAQLAGG-IEIR 154 Pyrococcus horikoshii
15899149  91 EYK-------LSVYSEVPLGYGYGLSGAISLAYALGVKELTPIS--EEDAVNTAHLSDVLSGNGLGDVIAQYYGGgLVYR 161 Sulfolobus solfatar...
15789544  78 VTA-----R-VTAETPLPLGAGFGVSGATALAAALAANEVFGCGcsENELVQVAHVADAEAGTGLGDVVAQARGG-LPVR 150 Halobacterium sp. N...
20090143 173 LHPGGPEFGRIDRIPAPE--ARVFGIALGEISTDSILTDEVtAGKINAAGKVAMSELLKKPTLENFMHQAKDFASNTGLM 250 Methanosarcina acet...
11499236 131 KSAACPSRAELERFFWN---AEFDFVVMGEISTKDVIGDELkRRRIGEAGKRWTKEFLKKPTLENLFHCSNGFARETGLL 207 Archaeoglobus fulgidus
14601727 157 YSPGPPGEALVDCIPTPPg-LYIIAGEAGSMDTSRLIEMYS-SQRFVDEVSRSLSRIFREPSLDRFFEEAERVTRLLSLD 234 Aeropyrum pernix
3024949  142 KTPGFP--INVEKIVVDDd-YYIIIEIFGKKETKEIITNDIwIKKINEYGERCLNELLKNPTLENFVNLSYEFAVNTGLI 218 Methanocaldococcus ...
20094170 146 VGPGYPDEVLIHRIPVEPd-LRVLIYEPRPIETREALDGLS----GTEVALRYLKELERHPDLELALRRSLEFAERLGFS 220 Methanopyrus kandle...
15678605 161 TREGPPGYGRVDRIIQDG--LHVITRTLGELDTASVIHDDAhVRAINRMGGGMIGRLLKRPAPARFMELSREFAEGAGLI 238 Methanothermobacter...
14520599 155 IKEGGPGVAIVDNLIVEG--FKVLTISLGRLSTREVLDSDV-VEKIKVEGQKSLENLLANPTLETLMREARRFAEVTGLM 231 Pyrococcus abyssi
18314043 124 VKAGAPGIGEAYSMPCPK--VGVVTADLAQISTGHMLTSRH--SVIASAGAEAVAEFLKNPSFEAFLKIALNFSKRVGFL 199 Pyrobaculum aerophilum
14591577 155 IKEGGPGVAVVDNILVEG--FKVLTISIGKLETRKVLDSEV-VEKIKIAGKQALENLLRDPRPETLMKEARSFAVETGLM 231 Pyrococcus horikoshii
15899149 162 KKAGGLGYGEVEVINMDWsyYPIFSQPISQLPTKSIIKRSE-------IALKLIDDFLKNPSPLKFIEVAQQFTSSLGFS 234 Sulfolobus solfatar...
15789544 151 VEPGAPPHGSLDGVPAS---GRIEYVSFGGLSTSDVIGGET--DALSAAGADALAALRADPTVAEFVAASRRFARAAGLV 225 Halobacterium sp. N...
20090143 251 SSTAKDVIEAAHA-NGGL-ASQAMLGDTVFAIApyaqefPLFEALQEFGQVALQEFGQVLEY-GistCVPRLL 320 Methanosarcina acetivorans...
11499236 208 -ELVGDAVEAVES-AGGK-AAMVMLGKTVFAVN-------GFEALKEFG----EPFKARLDCcG----VRRL- 261 Archaeoglobus fulgidus
14601727 235 SRLVGVEAHRILSgVGDVyGYYVKKRVLVVAAG-------EGSVGEIVGRMAGAGLDVRLLKpSt--GPPRLE 298 Aeropyrum pernix
3024949  219 NEKILSICEDLK---FTVgASQSMLGNTLFCIS-------KKETLEDALSILKNPIVCNIYY----------- 270 Methanocaldococcus jannaschii
20094170 221 -EEVKLAKELSH---KHLgASIAMLSRTVFAVS------WEQDPQADVELPVSCSSFPEIISgIseiQCERGL 283 Methanopyrus kandleri AV19
15678605 239 PRELREPLEELS--EGTLgASMAMLGNTVFALSe----dPDAGGAGTST------YGIDQL--G-----ARFI 292 Methanothermobacter therma...
14520599 232 DDELKEIAREVDK-VISLpSSMIMLGKGIFAMVr----nEEVERVKELVKDLGVPYDIAEIYwGk-pTVGRWF 298 Pyrococcus abyssi
18314043 200 -DARMETLGKLP---GVLgLFAKKGVLVVFVER------DWILDVAHAVEALGKVHVETLRElR----VEPLL 258 Pyrobaculum aerophilum
14591577 232 SEDLIEIANEIDR-EISLpSSMIMLGKGIFALVr----eEEVEKVKEIVKDLDLQYDISYIYwGk-pVVGRWL 298 Pyrococcus horikoshii
15899149 235 -SEYPYSYRKKG---IIVkIFEPEYGVWIKHKI--------ASRGAYVI------------------------ 271 Sulfolobus solfataricus
15789544 226 DAAVADAIAAVQA-AGGE-AAMAMLGRTVFALG--------T-GLSDAG---YDAASCAIHHgG---ASLR-- 279 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap