Conserved Protein Domain Family
AroK2

?
COG1685: AroK2 
Archaeal shikimate kinase [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 224599
View PSSM: COG1685
Aligned: 12 rows
Threshold Bit Score: 261.505
Threshold Setting Gi: 14194472
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20090239  41 FEGHACAFGAGTIINAIATW-KGAAFGVDLKTFAEVSLFEgks-giKGSIEGTPEGDTRLIEHCVELVLERFGLELEGTI 118 Methanosarcina acet...
14194464   1 -MMRAKAYAAGTVLNALPTG-IGSAFGIEMHTIVKLRPSD------ELKVF---VNGVERRSIVAERILNSMDVT--AEV 67  Archaeoglobus fulgidus
14194472   1 -MARARASGGLTIVNAIGHGrLGGAAGLGLWVESRVREARglwagvSLTPRGERRLPPRVLEAAATAACSLGACVEGLEA 79  Aeropyrum pernix
14194467   1 MEGKAYALASGTIINAIATG-KGSAFGLDLKVYAKVKLIDdgknkiEGKVLDNPNIKPNLIVRCVKNTLDYFGLNYSAYV 79  Methanocaldococcus ...
20095046   1 -MGEGIAYAAGTVVNAISAK-KGCAYALDLTVSVRAELS-------DSTEIHTDVEDTSLVERCVEVVGEHVGQELNFEI 71  Methanopyrus kandle...
14194463   4 VKKTVRSPGSATVINAIATG-RGSAFGIGLRVEAEAELIDsg---vECIS--REGADTSLMELCTRMVIEHYGVDAGVRV 77  Methanothermobacter...
14194471   1 MRGSGRASSAITIVNAFATG-KGAAIGIELWTEARVRVTGdgevrgKIVVKGEEFKDYRLVNSVISVLREVTGEPFGVRF 79  Pyrococcus abyssi
18312998   2 ECASGCAYGGGTIINAIATG-HGAAFPISLRVAAEVCLSD------SPSVSTYADVDVGPIYKILTRLGEKLGVG-PVSV 73  Pyrobaculum aerophilum
15897250   4 VCEIMQAYGGVSIVNALPSW-YGSSMAINLKVKVEIR---------EGKR--VYSQESELIKTILNYFKEKYSIP-DIEV 70  Sulfolobus solfatar...
13542149   2 KFAEATTNGGISILSAFIDG-LGGAFSIDLPLTATV----------Y-------AGTRRREDRLMEAIRSEFGIKDQLTY 63  Thermoplasma volcanium
14194468   2 KYARVRTHGGVSIISAFIDG-MGGAFSIDVPMTVTV----------R-------EGTCSEEKKISEDIRRYLSIATCFRF 63  Thermoplasma acidop...
14194469   1 MDGRAVAPAAGTVLNALATG-VGAAFALDIDTEASVSVTPses-gvSGEIAGHPEADTALVERCVSRVIDRYGDGQGGHV 78  Halobacterium sp. N...
20090239 119 ITGSEIPLAGGLKSSSAAANASVLATLRAVG-----EILPPLEIVKLGVRAAKEVGVTVTGAFDDACASFLGGIVVTDNR 193 Methanosarcina acet...
14194464  68 IVESEIPGGSGLGSSSAFVNALICAVKKMKG-----EELNAFEILRSNARFSLEAGISYTGAFDDASASMLGGFVVSDNR 142 Archaeoglobus fulgidus
14194472  80 EVHTGFPPGVGLKGSAALLASLVEAVLRLKG-----VRAPPWRAALAAARVSRGAGLSVTGALDDHAASLLEAPVITDNR 154 Aeropyrum pernix
14194467  80 ETKTEIPIKSGLSSSSATSNAVVLATFDALG-----EKIDDELILNLGIKSSFDEKLTVTGAYDDATASYYGGITITDNI 154 Methanocaldococcus ...
20095046  72 EVDSEIPIAMGLASSSAVSNAVVEALLKELG-----REPEPFEVVRLGVEASIRAGVTVTGAYDDACASYLGGLVLTLND 146 Methanopyrus kandle...
14194463  78 VTSSDLPVASGLSSSSAASNATVMAVSSLLSdefglQPMEDFEMLNMAVDASLQAGVSVTGAYDDASASFYGGLTVTDNM 157 Methanothermobacter...
14194471  80 EIHSDIPVGKGLKSSSAAANSLTKALVEALR-----LNIDDLSIVKLGVEAAKRAGVTITGAFDDACASYFGGLCITDNY 154 Pyrococcus abyssi
18312998  74 RITGDLPTAGGLKSSSATVNAIIIAMFKLAG-----READLFNIARLNAELSKEAGISVTGAFDDAVASAVGRSYLTDNY 148 Pyrobaculum aerophilum
15897250  71 DIESELPQKSGLKSSSAVSVALIAEIAKQYD-------LRNINPPILSAILSLKAGVSYTGALDDAVASYCGGIAFTYNK 143 Sulfolobus solfatar...
13542149  64 KVKSSIPAGYGLKSSSALVLALAKASLLYKS-----VDIEDADLLVRLANISKAVGLSATGALDDLCQALYGGYCITDNK 138 Thermoplasma volcanium
14194468  64 TVDSRIPSGYGLKSSSAYILALAKAMAVYSG-----IDISDMEIMTASADISKNSGLSMTGALDDLCQAMYGGYCLTDNR 138 Thermoplasma acidop...
14194469  79 RTESEVPLAAGLKSSSAAANATVLATLDALGv---aDEVDRVDAARLGVQAARDAGVTVTGAFDDAAASMLGGVAMTDNR 155 Halobacterium sp. N...
20090239 194 KMELVRR---EEADSKVLIFAPSKKAFSADTNVKRSRLIAPYVEMAYELALKGEYERAMTLNGFLYCGALGFDTEYMLKA 270 Methanosarcina acet...
14194464 143 KMRLIRT---DEFEGYSAVLIPKFS--RGKVDWRRLRERASEVEGAVEAAMRGEYCKAMKLNTEYICKMLGYPLEIAEKG 217 Archaeoglobus fulgidus
14194472 155 GMAILRLlprDGCRLTAVIGVPGVENPVENLDPSPFRRHSRLYDAAARLGLAGEWLPAMAVSGVAGALALGVEG-LASRL 233 Aeropyrum pernix
14194467 155 ERKILKRd-kMRDDLNVLILIPN---LEKNVDVNRMKLIKDYVEIAFNEAINGNYFKALFLNGILYASALNFPTNIAIDA 230 Methanocaldococcus ...
20095046 147 QHRVLDIr--ELPYPYAVILLPGGKVETSEVDVNRLELLAPAAETAFRRAMTGDYRGAMLINSAVYCSALGHEFEPVVEA 224 Methanopyrus kandle...
14194463 158 ERRIILRe--PMENQKVLIYMPDRKSLTAQSDVPRMKLLAPWVDMAFREVLDGRVHSALTLNGILYCASLGFDPGIALDA 235 Methanothermobacter...
14194471 155 EMEILVKr--EINPETVVLLIPRETVLTESLKGVDFSKISPFIGEALRLAISGEWKKALVINGLLYSTFLGYDLAPMREA 232 Pyrococcus abyssi
18312998 149 KMIVLREl--DVSGRAVVLIPPYEK--R-RQRLEEMRAIAPVIRTAVAYAGLGMWREAMLINAVAYGYALGYPPEPTLEA 223 Pyrobaculum aerophilum
15897250 144 MFRIVKLe-nLEDNLSILILAKGGR--QKPVNLNELRKYSHVFEEIFKIALK-DYLTAMKMNGILIANILGYSLEPIEIA 219 Sulfolobus solfatar...
13542149 139 RMKIIKRg--KLPELAVLVCARGETRPSRSINIRG--NYFKVARSAENLAQRGFIFQAAVLNGFIYGTIFGIDLETVRKI 214 Thermoplasma volcanium
14194468 139 KMKILRRg--RLPEMPVLVCADGDKRSSGKVSIEG--HFTNAIRRVEDLAFKGRIFDAAVANGLIYGSIFGMDLRLIGSM 214 Thermoplasma acidop...
14194469 156 EDDLLFR---DAVEWHAAVWTPPERAYSADADVARCERVSGLAEHVAALAAAGDYGTAMTVNGLAFCAALDFPTAPAVTA 232 Halobacterium sp. N...
20090239 271 LECGVTGVSLSGTGPSYAALVKAEq-vKELKSAWESCgmeGKVIETSINN-RDAISFKG 327 Methanosarcina acetivorans C2A
14194464 218 WEK-GICCGISGNGPSYVAFGSKNe-mEALAETWGEY---GRVYVRRVAD-EPAEDVVI 270 Archaeoglobus fulgidus
14194472 234 YEAGAAAAGVTGKGPAVFALTERP---RGAAEVLETAg--YEVVEARFKWcG------- 280 Aeropyrum pernix
14194467 231 LDAGAITAGLSGTGPSYIAMVEDE----NVEKVKEKLnryGKVILTKPNN-DGASIY-- 282 Methanocaldococcus jannaschii
20095046 225 LEAGAAAAGLSGTGPAFVALCETKsdvREVSEVWSDR---GEVLETRTVGpERARGAQA 280 Methanopyrus kandleri AV19
14194463 236 LEAGALAAGLSGTGPSFVALTHEDs-eADIIDAWENLe--GDVLVTSVDN-EGTRVLE- 289 Methanothermobacter thermautotrophicus
14194471 233 LKL-GAFVGLCGKGPAFFAIADEP---EEIIEAWSSF---GDVIATSLR---------- 274 Pyrococcus abyssi
18312998 224 LKLGAVG-GVSGTGPAHVFIAENP---EEVAAALSKY---GRVYVVDIPQ-SPCST--- 271 Pyrobaculum aerophilum
15897250 220 LKKGALAAGISGNGPSYFAVSKNGe-eGPIYESLKKF---GDVIIVRPVS-LDCKDLSI 273 Sulfolobus solfataricus
13542149 215 EENGANYASQSGKGPAVFGLFTDP---SDAKRAKMDIg-fGIVTKINNHG-IRYRIYDS 268 Thermoplasma volcanium
14194468 215 LKAGALYSSQSGKGPAIFGIFADR---RSAMNARSDIg-fGIVTKINNQG-IRYWKYDS 268 Thermoplasma acidophilum
14194469 233 LPH-AAGVSLSGTGPSYVAVGDEDg-iEEVSTRWHENp--GTVRETTTQL-AGARTT-- 284 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap