Conserved Protein Domain Family
FliL

?
COG1580: FliL 
Flagellar basal body-associated protein FliL [Cell motility]
Statistics
?
PSSM-Id: 224496
View PSSM: COG1580
Aligned: 21 rows
Threshold Bit Score: 97.3953
Threshold Setting Gi: 15639369
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15645428   3 EEQENTAQQPPKKSKALLFVIIGSVLVMLLLVGVIIMLLMGNKeeskenaskntqevqanpmanknQEAKEGSNI--QQY 80
gi 120342     1 ----MTDYAISKKSKRSLWIPILVFITLAACASAGYSYWHS-------------------------HQVAADDKA--QQR 49
gi 120342     1 ----MTDYAISKKSKRSLWIPILVFITLAACASAGYSYWHS-------------------------HQVAADDKA--QQR 49
gi 120342     1 ----MTDYAISKKSKRSLWIPILVFITLAACASAGYSYWHS-------------------------HQVAADDKA--QQR 49
gi 15596639   5 EATPADAGAPSGGKSKLKLILLIVVGLLLAIGLSVGGTWFFLSksl------------------kaEKTEEVASEaaKPG 66
gi 15600426   1 ----------------------MRTPIALSLALCLSLFPSFAS-------------------------AEEAAPE--GEG 31
gi 17548600   2 AEAAAANTAPAPAKGGSTKLLLIILIVLVLIGMGGAAAWFFLG-----------------------GGSHAAGPA--APP 56
gi 120343     1 ----MTDSAINKKSKRSIWIPLLVLITLAACATAGYSYWRMQ------------------------QQPTTNAKA--EPA 50
gi 15639369   1 -------------------------MRTHSAPRETQTRRTTR-------------------------GIAQRES-----A 25
gi 15642126   1 -MAEEDLGTEAPKGKKKLLIIIIAAVVLLAGGGGAAFFMMGSGgd-------------------eaAADAEQKTEqvAAP 60
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15645428  81 LVLGPLYAIDAPFAVNLVSQ-NGRRYLKASISLELSNEKLLNEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEI 159
gi 120342    50 VVPSPVFYALDTFTVNLG---DADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKKNLIAEI 126
gi 120342    50 VVPSPVFYALDTFTVNLG---DADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKKNLIAEI 126
gi 120342    50 VVPSPVFYALDTFTVNLG---DADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKKNLIAEI 126
gi 15596639  67 KQPALYEILAPAFVVNFNQN-GRQRYMQVGVALMGRDKAQMDALREHMPLVRNKLVMLFSSQSFDSLVTPVGKEMLRQQA 145
gi 15600426  32 ANKPVYVDLTPALVGNYGSG-PRLQYYKADIALQVADKDAATKVEHHEPLIRNQLIMLFAQQTDQSLGTVEAKESLRQEA 110
gi 17548600  57 KPKEPVFVPMETLTVNLQPEeGNDRYLQIAITFKSYNKHAEEEIKSYTPELRSRVLMLLSSKAPAELYSNEGKAKLAKEI 136
gi 120343    51 PPPAPVFFALDTFTVNLG---DADRVLYIGVTLRLKDEATRARLNEYLPEVRSRLLLLFSRQNAAELSTEAGKQKLIAAI 127
gi 15639369  26 HAVYAELGRLRALSADKQ---PVSVIITPLLQYPAADHALYEELVQKKEQLRRASLAWCAQHTAQELHM-LGPEQLKIAL 101
gi 15642126  61 TDPVSYVNIAQPFVFNVTGd-AKDRLVQIKVQLMVRGSENENLARYHSPLVESSLLATFASATVEQLRTPNGRIELRDKA 139
                       170       180
                ....*....|....*....|....*...
gi 15645428 160 KSHLNSFLIDG----FIKNVFFTDFIIQ 183
gi 120342   127 KTTLSTPLVAGqpkqDVTDVLYTAFILR 154
gi 120342   127 KTTLSTPLVAGqpkqDVTDVLYTAFILR 154
gi 120342   127 KTTLSTPLVAGqpkqDVTDVLYTAFILR 154
gi 15596639 146 TAGLQELAKKEtgqlAIEQVLFTNFVLQ 173
gi 15600426 111 LKQVQQTLEQEegkpLVTDLLFNNLIVQ 138
gi 17548600 137 VEQCEQAYKAVgkesPVVDVLFTNFVIQ 164
gi 120343   128 KETLAAPLVAGqpkqVVTDVLYTAFILR 155
gi 15639369 102 RDALNTQLSLG----RVTHVFLEEFIIL 125
gi 15642126 140 TDDIKAALNQAvgkpVIEKVLFTDFVMQ 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap