Conserved Protein Domain Family
CelB

?
COG1455: CelB 
Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 224372
View PSSM: COG1455
Aligned: 37 rows
Threshold Bit Score: 78.4039
Threshold Setting Gi: 16799987
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

COG1455 is a member of the superfamily cl21492.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15927770   2 MQKLIA----QIEKGKPFFEKLSRNIYLRAIRDGFISAMPVILFSSIFLLIAYVPNIFG----FKWDK-----GMEAILM 68
gi 15896217   1 MRKLIA----LIEKMKPFFEKVSNNPYLRAIRDGFLSCMPVILFSSIFLLIACVPNAWG----FYWPN-----NVNDILM 67
gi 15900243   1 MDQQNGlfgfLENHVMGPMGKLAQFKVVRAITAAGMAAVPFTIVGSMFLVFSILPQAFSfwpiVADIFsasfdKFTSLYM 80
gi 15900393   1 MDKLVA----AIEKQQGKFEKISTNNYMMAIKDGFIATMPLIMFSSFLMIIIMIPKNFG----VELPS-----PAIVWMR 67
gi 15901050   1 MNKLIA----FIEKGKPFFEKLSRNIYLRAIRDGFIAGMPVILFSSIFILIAFVPNSWG----FKWSD-----EVVAFLM 67
gi 15675726   1 MNGLIA----QIEKGKPFFEKISRNIYLRAIRDGFIAGMPVILFSSIFILIAYVPNAWG----FHWSK-----DIENLLM 67
gi 16799403   1 MRFNTIse-kMDQYISPLANKLSQQRHLKATRDAFMSMLPITLFGSIPIILKAAPVTDDtkngFLLAWanfaeKYDLILN 79
gi 16799948   7 QSFMNRfiafMEKYFEPVAARIEKQRHISSIKNGMIALISVLIIGSFSLIISAIGNMFPag-sVVKEFfv---qnAAALN 82
gi 16799987   1 MNNKVMd--fMTNKFAPKVNKVVKNPWVSAIQDAIMSALPLVFVGSLVTIVSLLKNLFP-----GMPD---------F-S 63
gi 16801521   1 MKALERf---LSKWLLPFAKVLESNTQMKAIRQGMMALVPITLVGAVPVLFQQLGGIPk----LPSWIaavaeYINNITS 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15927770  69 KPYNYTMGLVAFLVAGTTAKSLTDSFNRKlESTn---qINFISTMLAAMCGFLFLA-----------SDPAKDGGf---- 130
gi 15896217  68 KAYNYSMGILALLMVATIAKSLTDSINGKlPKLr---qINNVSVMIVSIICFILIG-----------VQPIKGGf----- 128
gi 15900243  81 VANYATMGSLSLYFVLSLAYELTKIYAEEeELNmnplnGALLALMAFVMTVPQIIFdggmmktvtslKEGAVIADgwamg 160
gi 15900393  68 KVYMLTMGVLGIIVSGTVGKSLVGNVNRKmPHGk---vINDISAMLAAICSYLVLT-----------VTLVVDEKtgsts 133
gi 15901050  68 KPYSYSMGILALLVAGTTAKSLTDSVNRSmEKTn---qIKYMSTLLAAIVGLLMLA-----------ADPIESGl----- 128
gi 15675726  68 TPYNYSMGILGLFVAGTTAKALTDSMNRSlPSTn---qINFISTMLAAIVGFLLMA-----------ANPAKDGGf---- 129
gi 16799403  80 WISGITLGAMSLYICVGITYYLCKHYHED-FLR-----PLMFSIAGFFMLVLNPIKm----------gWDGKEVD----- 138
gi 16799948  83 LPFQFTFGLLSIYAAITISYSHAKQMKVPvLHS-----VMAAVMVTLILNTK---------------MVDGVLN------ 136
gi 16799987  64 MISNFSFGMFGLVVAFLIPYYLMEKKRE---------------------------------------------------- 91
gi 16801521  74 PIHFATFGLMSVYVAIFVAYYYAKERNLW-DIG-----AIVTALMSFVVVAVRP-------------LEAGGSD------ 128
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15927770 131 -lSAFMGTKGLLTAFLSAFVTVIVYNFCVK-RNITIKMPKEVPPNISQVFKDLIPFSAVIIILYALDLVIRNSF-KSNVA 207
gi 15896217 129 -sSDFMGTKGLLSAFVVAFIVPNIYKLFVK-NNVTIKLPEEVPHNVAQTFEDLIPLAASVLFFWLFDLVFRQVT-GEVFS 205
gi 15900243 161 nvVARFGTTGIFTAIIMAIVTVLIYRMCVK-HNWVIKMPEAVPEGVSRGFTALVPGFVVAFVVIFINGLLVAMG--TDIF 237
gi 15900393 134 lsTNYLGSQGLITSFVSAFITVNVYRFCIK-RDITIHLPKEVPGAISQAFRDIFPFSFVLLISGLLDIVSRFSL-DVPFA 211
gi 15901050 129 -aTGFLGTKGLLSAFLAAFVTVAIYKVCVK-NNVTIRMPDEVPPNISQVFKDVIPFTLSVVSLYALDLLARYFV-GSSVA 205
gi 15675726 130 -lTGFMGTKGLLTAFIAAFITVNVYKACVK-NNVTIRMPEEVPPNISQVFKDLIPFTLSVVLLYVIELIVHTTL-GVNVA 206
gi 16799403 139 --ISFLDGRGILLSIFVAIVTVEGYHWMRKkNVGRITMPDSVPASLSETFAALVPGIILMTFFSIIFIIFNLLD-TTAIQ 215
gi 16799948 137 --TEFLDSRGLFIAIFAALISVELIGLFIR-KNITIQIKG-LPAGIATTFEAIIPLVVLLFSAVGLSILMQSVTsGQIIP 212
gi 16799987     --------------------------------------------------------------------------------
gi 16801521 129 --VTYLAGEGIFVALVISLLSVEILHIFKNkLKFTINLGQGVPTPILRSFENLWPILFSVLIVAILSFGVESIS-GIRVV 205
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15927770 208 EGILKLFEPLFTAADGWIGVTIIFGAFALFWFVGIHGPSIVEPAIAAITYANIEANFKLLQAGe--HADKIITSGTQMFi 285
gi 15896217 206 SWILDVLKPLFTAADGYVGLAVIYGAMAMFWFVGIHGPSIVEPAVTAIYIANVEANLKLHQAGh--HATYVLTHGTSYFi 283
gi 15900243 238 KVIAIPFGFVSNLTNSWIGLMIIYLLTQLLWIVGIHGANIVFAFVSPIALANMAEN----AAG----GHFAVAGEFSNMf 309
gi 15900393 212 QVFQQLLTPIFKGAESYPAMMLIWFMCALLWFVGIHGPSIVLPAVTALQLSNMEENAQLLANGq--FPYHSLTPNFGNYi 289
gi 15901050 206 ESIGKFFAPLFSAADGYLGITIIFGAFAFFWFVGIHGPSIVEPAIAAITYANAEVNLNLLQQGm--HADKILTSGTQMFi 283
gi 15675726 207 ESIGKLLAPLFQAADGYVGITIIFGAFAFFWFVGIHGPSIVEPAIAAITYANAETNLQLLQAGe--HADKILTSGTQMFi 284
gi 16799403 216 FLYEKM-APSFKAADSLPFTILSIFLVHLFWFFGVHDAALAG-ILGPIRDGNLSINAAEKMAGq-dLTNIFTTPFWTYF- 291
gi 16799948 213 EAFTTMLAPAINSIDTPYAVFLICFLEMLFWFIGLNGYAILIGFVLPFMTQYLGANAAAYAAGe-pIPYVFAPNFWDYF- 290
gi 16799987     --------------------------------------------------------------------------------
gi 16801521 206 ELIQTLFSPLTSLVNTLPGIMLIIFIQQLLWWFGIHGYSVMAPVWLSVAFQNVDANAAALAKGeplSSMLIFTPDFMWSi 285
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15927770 286 VTFGGTGATLVVPFMFMWMTKSKRNKAIGRASVVPTFFGVNEPILFGAPLVLNPVFFIPFVLAPIVNVWIFKLFVEVLGI 365
gi 15896217 284 ATIGGTGATLMLTVMFAFIAKSKQLKAVGRTSIIPVCFAVNEPILFGAPIVLNPIFFVPFILTPILNVWIFKFFIDNLGM 363
gi 15900243 310 VIAGGSGATLGLCLYIAFASKSEQLKAIGRASVVPALFNINEPLIFGLPIIYNPALAIPFILAPMVTATIYYVANSLNFI 389
gi 15900393 290 AAIGGTGATFVVPFILIFFMRSKQLKSVGKATITPVLFAVNEPLLFGMPVILNPYLFVPFLMTPPVNVFLGKVFIDFFGM 369
gi 15901050 284 VTMGGTGATLVVPFMFMWLTKSKRNRAIGRASVVPTFFGVNEPILFGAPLVLNPIFFIPFIFAPIANVWIFKFFIETLGM 363
gi 15675726 285 VTMGGTGATLVVPFMFMWLTKSKRNKAIGRASVVPTFFGVNEPILFGAPLVLNPIFFIPFILAPIVNVWIFKFFIDTLGM 364
gi 16799403 292 VIIGGSGSVLAL-AFLMMRSKSKQLSTVGKVGFLPSIFGISEPLIFGTPLMLNPIFFFPFIFTSVFNGVITYLCMYFGIV 370
gi 16799948 291 MGFSGSGITGALVILALFSKS-RELKAVGKVSVVPAIFTISEPVVFGLPICFNPYLFIPFVLGTPILAVGQWFVFHFGWV 369
gi 16799987     --------------------------------------------------------------------------------
gi 16801521 286 VGVTGAGVTGALVVIMMFSKS-KRYKTLGRLALIPTFFSINEPVMFGVPIVLNPRFFIPMMVAPQIAALIGWFSIKLGLM 364
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15927770 366 NSFSVNLPWTTPGPLGIIMGTGFGLWSFVLAITLIVVDIIIYYPFLKVYDSEIldeEEGRKE--SNSDL 432
gi 15896217 364 NGFIYIIPWTTPAPIGLILGTGFAKLAFILAPLLLVVDFVMYYPFFKVYDRELvleEAERAKheFDGEL 432
gi 15900243 390 KPIIAQVPWPTPVGIGAFLGT-ADLRAVLVALVCAFAAFLVYLPFIRVYDQK----LVKEEQgi----- 448
gi 15900393 370 NGFYIQLPWTFPGPLGLLIGTNFQLISFVFLSLILVVDILIYLPFCRAYDRQLlvkEDIAS---SNDII 435
gi 15901050 364 NSFTANLPWTTPAPLGLVLGTNFQVLSFILAALLIVVDVVIYYPFLKVYDEQIleeERSGK---SNDEL 429
gi 15675726 365 NSFTANLPWTTPAPLGLILGTNFQVLAFILAALLIVVDVIIYYPFLKVYDEQIlaeEAAGTN--SSDAL 431
gi 16799403 371 GKTFAVFSWQMPAPIGAFLST-MDWRAIVLVFILIFLNGLMYYPFLKVYEKNLvalEKEAEEenIAAN- 437
gi 16799948 370 RPPI-ANVGGTPIPLAQYLAT-MDWRAIILIIFVLAVAVCMYYPFFKMYEKSLikeETVVSErqAAHDA 436
gi 16799987     ---------------------------------------------------------------------
gi 16801521 365 NPFT-MVSPYVPVPIGAIVAS-FDWRYIIVLGLILICSALIYYPFFKIAEKEAlvqENSGDQeaSLDDF 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap