Conserved Protein Domain Family
CelB

?
COG1455: CelB 
Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 224372
View PSSM: COG1455
Aligned: 37 rows
Threshold Bit Score: 78.4039
Threshold Setting Gi: 16799987
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15927770   2 MQKLIA----QIEKGKPFFEKLSRNIYLRAIRDGFISAMPVILFSSIFLLIAYVPNIFG----FKWDK-----GMEAILM 68  Staphylococcus aure...
15896217   1 MRKLIA----LIEKMKPFFEKVSNNPYLRAIRDGFLSCMPVILFSSIFLLIACVPNAWG----FYWPN-----NVNDILM 67  Clostridium acetobu...
15900243   1 MDQQNGlfgfLENHVMGPMGKLAQFKVVRAITAAGMAAVPFTIVGSMFLVFSILPQAFSfwpiVADIFsasfdKFTSLYM 80  Streptococcus pneum...
15900393   1 MDKLVA----AIEKQQGKFEKISTNNYMMAIKDGFIATMPLIMFSSFLMIIIMIPKNFG----VELPS-----PAIVWMR 67  Streptococcus pneum...
15901050   1 MNKLIA----FIEKGKPFFEKLSRNIYLRAIRDGFIAGMPVILFSSIFILIAFVPNSWG----FKWSD-----EVVAFLM 67  Streptococcus pneum...
15675726   1 MNGLIA----QIEKGKPFFEKISRNIYLRAIRDGFIAGMPVILFSSIFILIAYVPNAWG----FHWSK-----DIENLLM 67  Streptococcus pyoge...
16799403   1 MRFNTIse-kMDQYISPLANKLSQQRHLKATRDAFMSMLPITLFGSIPIILKAAPVTDDtkngFLLAWanfaeKYDLILN 79  Listeria innocua
16799948   7 QSFMNRfiafMEKYFEPVAARIEKQRHISSIKNGMIALISVLIIGSFSLIISAIGNMFPag-sVVKEFfv---qnAAALN 82  Listeria innocua
16799987   1 MNNKVMd--fMTNKFAPKVNKVVKNPWVSAIQDAIMSALPLVFVGSLVTIVSLLKNLFP-----GMPD---------F-S 63  Listeria innocua
16801521   1 MKALERf---LSKWLLPFAKVLESNTQMKAIRQGMMALVPITLVGAVPVLFQQLGGIPk----LPSWIaavaeYINNITS 73  Listeria innocua
15927770  69 KPYNYTMGLVAFLVAGTTAKSLTDSFNRKlESTn---qINFISTMLAAMCGFLFLA-----------SDPAKDGGf---- 130 Staphylococcus aure...
15896217  68 KAYNYSMGILALLMVATIAKSLTDSINGKlPKLr---qINNVSVMIVSIICFILIG-----------VQPIKGGf----- 128 Clostridium acetobu...
15900243  81 VANYATMGSLSLYFVLSLAYELTKIYAEEeELNmnplnGALLALMAFVMTVPQIIFdggmmktvtslKEGAVIADgwamg 160 Streptococcus pneum...
15900393  68 KVYMLTMGVLGIIVSGTVGKSLVGNVNRKmPHGk---vINDISAMLAAICSYLVLT-----------VTLVVDEKtgsts 133 Streptococcus pneum...
15901050  68 KPYSYSMGILALLVAGTTAKSLTDSVNRSmEKTn---qIKYMSTLLAAIVGLLMLA-----------ADPIESGl----- 128 Streptococcus pneum...
15675726  68 TPYNYSMGILGLFVAGTTAKALTDSMNRSlPSTn---qINFISTMLAAIVGFLLMA-----------ANPAKDGGf---- 129 Streptococcus pyoge...
16799403  80 WISGITLGAMSLYICVGITYYLCKHYHED-FLR-----PLMFSIAGFFMLVLNPIKm----------gWDGKEVD----- 138 Listeria innocua
16799948  83 LPFQFTFGLLSIYAAITISYSHAKQMKVPvLHS-----VMAAVMVTLILNTK---------------MVDGVLN------ 136 Listeria innocua
16799987  64 MISNFSFGMFGLVVAFLIPYYLMEKKRE---------------------------------------------------- 91  Listeria innocua
16801521  74 PIHFATFGLMSVYVAIFVAYYYAKERNLW-DIG-----AIVTALMSFVVVAVRP-------------LEAGGSD------ 128 Listeria innocua
15927770 131 -lSAFMGTKGLLTAFLSAFVTVIVYNFCVK-RNITIKMPKEVPPNISQVFKDLIPFSAVIIILYALDLVIRNSF-KSNVA 207 Staphylococcus aure...
15896217 129 -sSDFMGTKGLLSAFVVAFIVPNIYKLFVK-NNVTIKLPEEVPHNVAQTFEDLIPLAASVLFFWLFDLVFRQVT-GEVFS 205 Clostridium acetobu...
15900243 161 nvVARFGTTGIFTAIIMAIVTVLIYRMCVK-HNWVIKMPEAVPEGVSRGFTALVPGFVVAFVVIFINGLLVAMG--TDIF 237 Streptococcus pneum...
15900393 134 lsTNYLGSQGLITSFVSAFITVNVYRFCIK-RDITIHLPKEVPGAISQAFRDIFPFSFVLLISGLLDIVSRFSL-DVPFA 211 Streptococcus pneum...
15901050 129 -aTGFLGTKGLLSAFLAAFVTVAIYKVCVK-NNVTIRMPDEVPPNISQVFKDVIPFTLSVVSLYALDLLARYFV-GSSVA 205 Streptococcus pneum...
15675726 130 -lTGFMGTKGLLTAFIAAFITVNVYKACVK-NNVTIRMPEEVPPNISQVFKDLIPFTLSVVLLYVIELIVHTTL-GVNVA 206 Streptococcus pyoge...
16799403 139 --ISFLDGRGILLSIFVAIVTVEGYHWMRKkNVGRITMPDSVPASLSETFAALVPGIILMTFFSIIFIIFNLLD-TTAIQ 215 Listeria innocua
16799948 137 --TEFLDSRGLFIAIFAALISVELIGLFIR-KNITIQIKG-LPAGIATTFEAIIPLVVLLFSAVGLSILMQSVTsGQIIP 212 Listeria innocua
16799987     -------------------------------------------------------------------------------- Listeria innocua
16801521 129 --VTYLAGEGIFVALVISLLSVEILHIFKNkLKFTINLGQGVPTPILRSFENLWPILFSVLIVAILSFGVESIS-GIRVV 205 Listeria innocua
15927770 208 EGILKLFEPLFTAADGWIGVTIIFGAFALFWFVGIHGPSIVEPAIAAITYANIEANFKLLQAGe--HADKIITSGTQMFi 285 Staphylococcus aure...
15896217 206 SWILDVLKPLFTAADGYVGLAVIYGAMAMFWFVGIHGPSIVEPAVTAIYIANVEANLKLHQAGh--HATYVLTHGTSYFi 283 Clostridium acetobu...
15900243 238 KVIAIPFGFVSNLTNSWIGLMIIYLLTQLLWIVGIHGANIVFAFVSPIALANMAEN----AAG----GHFAVAGEFSNMf 309 Streptococcus pneum...
15900393 212 QVFQQLLTPIFKGAESYPAMMLIWFMCALLWFVGIHGPSIVLPAVTALQLSNMEENAQLLANGq--FPYHSLTPNFGNYi 289 Streptococcus pneum...
15901050 206 ESIGKFFAPLFSAADGYLGITIIFGAFAFFWFVGIHGPSIVEPAIAAITYANAEVNLNLLQQGm--HADKILTSGTQMFi 283 Streptococcus pneum...
15675726 207 ESIGKLLAPLFQAADGYVGITIIFGAFAFFWFVGIHGPSIVEPAIAAITYANAETNLQLLQAGe--HADKILTSGTQMFi 284 Streptococcus pyoge...
16799403 216 FLYEKM-APSFKAADSLPFTILSIFLVHLFWFFGVHDAALAG-ILGPIRDGNLSINAAEKMAGq-dLTNIFTTPFWTYF- 291 Listeria innocua
16799948 213 EAFTTMLAPAINSIDTPYAVFLICFLEMLFWFIGLNGYAILIGFVLPFMTQYLGANAAAYAAGe-pIPYVFAPNFWDYF- 290 Listeria innocua
16799987     -------------------------------------------------------------------------------- Listeria innocua
16801521 206 ELIQTLFSPLTSLVNTLPGIMLIIFIQQLLWWFGIHGYSVMAPVWLSVAFQNVDANAAALAKGeplSSMLIFTPDFMWSi 285 Listeria innocua
15927770 286 VTFGGTGATLVVPFMFMWMTKSKRNKAIGRASVVPTFFGVNEPILFGAPLVLNPVFFIPFVLAPIVNVWIFKLFVEVLGI 365 Staphylococcus aure...
15896217 284 ATIGGTGATLMLTVMFAFIAKSKQLKAVGRTSIIPVCFAVNEPILFGAPIVLNPIFFVPFILTPILNVWIFKFFIDNLGM 363 Clostridium acetobu...
15900243 310 VIAGGSGATLGLCLYIAFASKSEQLKAIGRASVVPALFNINEPLIFGLPIIYNPALAIPFILAPMVTATIYYVANSLNFI 389 Streptococcus pneum...
15900393 290 AAIGGTGATFVVPFILIFFMRSKQLKSVGKATITPVLFAVNEPLLFGMPVILNPYLFVPFLMTPPVNVFLGKVFIDFFGM 369 Streptococcus pneum...
15901050 284 VTMGGTGATLVVPFMFMWLTKSKRNRAIGRASVVPTFFGVNEPILFGAPLVLNPIFFIPFIFAPIANVWIFKFFIETLGM 363 Streptococcus pneum...
15675726 285 VTMGGTGATLVVPFMFMWLTKSKRNKAIGRASVVPTFFGVNEPILFGAPLVLNPIFFIPFILAPIVNVWIFKFFIDTLGM 364 Streptococcus pyoge...
16799403 292 VIIGGSGSVLAL-AFLMMRSKSKQLSTVGKVGFLPSIFGISEPLIFGTPLMLNPIFFFPFIFTSVFNGVITYLCMYFGIV 370 Listeria innocua
16799948 291 MGFSGSGITGALVILALFSKS-RELKAVGKVSVVPAIFTISEPVVFGLPICFNPYLFIPFVLGTPILAVGQWFVFHFGWV 369 Listeria innocua
16799987     -------------------------------------------------------------------------------- Listeria innocua
16801521 286 VGVTGAGVTGALVVIMMFSKS-KRYKTLGRLALIPTFFSINEPVMFGVPIVLNPRFFIPMMVAPQIAALIGWFSIKLGLM 364 Listeria innocua
15927770 366 NSFSVNLPWTTPGPLGIIMGTGFGLWSFVLAITLIVVDIIIYYPFLKVYDSEIldeEEGRKE--SNSDL 432 Staphylococcus aureus subsp. a...
15896217 364 NGFIYIIPWTTPAPIGLILGTGFAKLAFILAPLLLVVDFVMYYPFFKVYDRELvleEAERAKheFDGEL 432 Clostridium acetobutylicum
15900243 390 KPIIAQVPWPTPVGIGAFLGT-ADLRAVLVALVCAFAAFLVYLPFIRVYDQK----LVKEEQgi----- 448 Streptococcus pneumoniae TIGR4
15900393 370 NGFYIQLPWTFPGPLGLLIGTNFQLISFVFLSLILVVDILIYLPFCRAYDRQLlvkEDIAS---SNDII 435 Streptococcus pneumoniae TIGR4
15901050 364 NSFTANLPWTTPAPLGLVLGTNFQVLSFILAALLIVVDVVIYYPFLKVYDEQIleeERSGK---SNDEL 429 Streptococcus pneumoniae TIGR4
15675726 365 NSFTANLPWTTPAPLGLILGTNFQVLAFILAALLIVVDVIIYYPFLKVYDEQIlaeEAAGTN--SSDAL 431 Streptococcus pyogenes M1 GAS
16799403 371 GKTFAVFSWQMPAPIGAFLST-MDWRAIVLVFILIFLNGLMYYPFLKVYEKNLvalEKEAEEenIAAN- 437 Listeria innocua
16799948 370 RPPI-ANVGGTPIPLAQYLAT-MDWRAIILIIFVLAVAVCMYYPFFKMYEKSLikeETVVSErqAAHDA 436 Listeria innocua
16799987     --------------------------------------------------------------------- Listeria innocua
16801521 365 NPFT-MVSPYVPVPIGAIVAS-FDWRYIIVLGLILICSALIYYPFFKIAEKEAlvqENSGDQeaSLDDF 431 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap