Conserved Protein Domain Family
RnaY

?
COG1418: RnaY 
HD superfamily phosphodieaserase, includes HD domain of RNase Y [Translation, ribosomal structure and biogenesis, General function prediction only]
Statistics
?
PSSM-Id: 224336
View PSSM: COG1418
Aligned: 51 rows
Threshold Bit Score: 82.876
Threshold Setting Gi: 20092668
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13432023 357 EAAIEAGVVGLKPGLVQLLGRMYFRTsYSQNVLKHSVQVAHLTGIMADE-----LGL-DAALARRAGLMHDVGKSIDREI 430 Deinococcus radiodu...
11498823   1 --------MDVPEDVQRLWDKYKLD----ESVRRHCLTVARVAMKIAENirkkgHEV-DMDAVLKGALLHDIGRAITHDP 67  Archaeoglobus fulgidus
15672047   1 ----MIDLKKIKRFAQEIHDK-NND----GHGFDHIERVVALARKILLT-----EPSaNQELVLATCYLHDTYDEKLTDD 66  Lactococcus lactis ...
20092668   1 ----------MTTRIQAIKLLEEVG--CAPNVIEHCKEVASLAVEIAAKakaagNNV-NPELVEIGALLHDLGRCRTHG- 66  Methanosarcina acet...
2833583    1 --------------MEFEKALSILKNlCSENVVEHCLAVSEYAYELALAiknkgYEV-DVELVRLGGLLHDIGRSRTHG- 64  Methanocaldococcus ...
20093932   1 -------------MRDPIRDLERVG--CPEHVIEHCKAVCRLAEEMAERc---eEDV-DLNLVRTGALLHDIGRARTHG- 60  Methanopyrus kandle...
15679662   1 ---------------MSLRLLRVVG--CPEWVIDHSLAVRKKALELSRe-----LPV-DMKLVEEGAILHDIGRCRTSG- 56  Methanothermobacter...
15927664   1 ----MQQSDVISAAKKYMESIHQND--YTGHDIAHVYRVTALAKSIAEN-----EGVnDTLVIELACLLHDTVDEKVVD- 68  Staphylococcus aure...
13541902 159 psergkkvkiipdeqgCLDLLYKYG--ASDYLINHVKSVKELAVAIAKK-----TNA-DINLVTAGALLHDIGRTQVQG- 229 Thermoplasma volcanium
15789754   2 AAFVRDYLEASVENETDGGRMRWYPWhSAEYRFTHIMNVVDIAERIAEA------TSaNVDVVRVAALFHDIAKLEAEQD 75  Halobacterium sp. N...
13432023 431 EGT-HVEIGINLARRFGEPAEVIDAIAHHHDPENGETLYSVLVAAADAISAARPGARREALESYVRRLEQLEQIAVAFPG 509 Deinococcus radiodu...
11498823  68 FQ--HFIKSAEILRKEGVD----------EKIVRIAERHFSAGIN--AEEASKLGLIPKNYMPETLEEKIVSFADNLAMG 133 Archaeoglobus fulgidus
15672047  67 VPK-QKVKVAQFLNELKID------KKLIDELFMIIDNMSFSSNlIERKTLSLNGQIVQDADRLDAMGAWGIVRTLEYGW 139 Lactococcus lactis ...
20092668  67 --IsHAVEGFKLAQSKGVE----------PEVAEIIKRHIGAGVS--KEEAKELGLPEDDYFPRRLEEKIVAHADNLVKG 132 Methanosarcina acet...
2833583   65 --IeHGVVGAEILRELGFD----------EKLALIAERHIGAGIT--KEEAIELGLPPKDYLPITLEEKIVAHADNLIFG 130 Methanocaldococcus ...
20093932  61 --IdHAVVGANIVSELGYP----------KEVVRIVERHIGAGIP--KDEAKKLGLPPKDYIPETLEEKIVAHADNLTFG 126 Methanopyrus kandle...
15679662  57 --VeHAVEGARILEGFGYP----------PEVVRIVERHVGAGIP--PEEAKALGLPPGDYMPRTLEEKIVAHADNLING 122 Methanothermobacter...
15927664  69 -----ANKQYVELKSFLSS--LSLSTEDQEHILFIINNMSYRNGKNDHVTLSLEGQIVRDADRLDAIGAIGVARTFQFAG 141 Staphylococcus aure...
13541902 230 --ItHAVVGADILRREGID----------DRVVSIVEKHIGAGIQ--SEEAVKLGLPPDNYVPETIEEMIVAHADNLFAG 295 Thermoplasma volcanium
15789754  76 A---HAEEGARIARKYLETHG-QFPPSFVDQVAEAVSRHSYQGD---LMDLPLEARCLVEADLLDKAGANGAALMLLRMG 148 Halobacterium sp. N...
13432023 510 --VQQAYAI---QAGREVRVIVQPEK------VTDAQATLLARDIAGRVEQD---MEYPGQVQVTVVRESRAVGVAR 572 Deinococcus radiodurans
11498823 134 ---------------VREGTFEEF--------MRRLEEIDRKNPEMRWLTERt--RERARKMKEELERLSGLVF--- 182 Archaeoglobus fulgidus
15672047 140 akNRVFYDPn--LPPLDYNSKEDYHSqknnstLNHFYEKLFLLKDLLNTTEGkrlGEKRDKIMHLFVSQIEEEYKET 214 Lactococcus lactis sub...
20092668 133 --------------------------------TKRITINKRLELMNKRNISEh-vVQRVKKLAEEVEGLSR------ 170 Methanosarcina acetivo...
2833583  131 --------------------------------TKRVEIDDVIKKFEKRLGKNhpsIKRIILLNDEINNLLK------ 169 Methanocaldococcus jan...
20093932 127 --------------------------------TEHVPIKVVVRKFSERLGEDspaVKRLIELHNELVDLNAIPPELT 171 Methanopyrus kandleri ...
15679662 123 --------------------------------SDEVDIDFVIKKWSDRLGADhpsIESLKRLHEELLGHL------- 160 Methanothermobacter th...
15927664 142 hfGEPMWTEhmsLDKINDDLVEQLPPs----aIKHFFEKLLKLESLMHTDTAkmiAKERHDFMMMYLKQFFTEWNYH 214 Staphylococcus aureus ...
13541902 296 --------------------------------DKRLKLQQVVDNYRKKGLEDa--AERIAKLHKFLSTVIGQDMDEI 338 Thermoplasma volcanium
15789754 149 ------YEAr---THVDAAEMIQRv-------LDRGEDAAERVESDAASSIAhrrLKRVRWLHDWLTSEVPAMNDTG 209 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap