Conserved Protein Domain Family
FlhB

?
COG1377: FlhB 
Flagellar biosynthesis protein FlhB [Cell motility]
Statistics
?
PSSM-Id: 224295
View PSSM: COG1377
Aligned: 32 rows
Threshold Bit Score: 383.885
Threshold Setting Gi: 730801
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17549613   1 MSEDSDLEKTEPASARRLEQAREEGDVPQSRELVSFVLLATGALGLWVMG-ESIVRTASSFLARCLEFH-RYDYTRAQE- 77  Ralstonia solanacearum
17989459   2 ADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIAS-FLVIAVFVaAPAATRLAVFLRELIDRP-EDWLLNSAEd 79  Brucella melitensis
15895417 256 gLIFADSDKTEEATPKRKSEARKKGQVARSKEVPLAATLVAITFIISLGG-QTFFNGLGVMMQTFFQSYiHSNLTELD-- 332 Clostridium acetobu...
16125329   2 ADDTDPESKTEEPSAKKLSDARAKGDVIKSADIPQLASLAGAVSVILLAG-GWLTRDLMAALTPFIAHA-GTIDLSSGG- 78  Caulobacter crescen...
15618242   1 -----MGEKTEKATPKRLRDARKKGQVAKSQDFPSAVTFIVSMFTAFSLS-TFFFKHLGGFLVSMLSQ--APTRHDPVI- 71  Chlamydophila pneum...
15604810   1 -----MGEKTEKATPKRLRDARKKGQVAKSQDFPSAITFIVSMFLTFSLA-SFFAKHLGSFLVSIFKT--APQNHDPHL- 71  Chlamydia trachomatis
15832975   1 -----MANKTEKPTQKKLQDASKKGQILKSRDLTVSVIMLVGTLYLGYVF---DVHHIMSILEYILDHN-AKPDIWDY-- 69  Escherichia coli O1...
730801     1 ----MSSNKTEKPTKKRLEDSAKKGQSFKSKDLIIACLTLGGIAYLVSYG---SFNEFMGIIKIIIADN-FDQSMADYS- 71  Salmonella typhimurium
15803385   1 -----MANKTEKPTQKKLQDASKKGQILKSRDLTVSVIMLVGTLYLGYVF---DVHHIMSILEYILDHN-AKPDIWDY-- 69  Escherichia coli O1...
16799762   1 ---MAKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLLIVAGLLYFFG-EMFIKNTIKAFVALLKQP--PKLASMES- 73  Listeria innocua
17549613  78 QWQYVGAQFGPLAMVLAGLILMLVLAALS-PLALTRGAVSFKPLTPDITRLIGMHGLKRMFSVQGLLELPRLLAKLVLVG 156 Ralstonia solanacearum
17989459  80 ATRLFSVLALAVGAALVPVFIIIPLAGIAaSAFQNAPRFVGERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAAS 159 Brucella melitensis
15895417 333 LRRIIIFVILNAGKFIFMFGVPVMVVGIVaNIAQTGWITTTEPIKPDLKKLNPISGFKRIFSMTTIVNLLKDLVVVAVLS 412 Clostridium acetobu...
16125329  79 AMIVLKQALLAALPALVLVMVVTAFAGAAaHIAQTGFLLTPEKIKPDFQKLDLIKGLGRIFGPDGMVQFLKSAVKFLLTG 158 Caulobacter crescen...
15618242  72 TLFYLKNCLMLILTASLPLLGAVAVVGVIvGFLIVGPTFSTEVFKPDIKKFNPIENIKQKFKIKTLIELIKSILKIFGAA 151 Chlamydophila pneum...
15604810  72 AVYYLKNCLILILTVSLPLLGAVGFVGLLiGFLIVGPTFSTEVFKPDLKKFNPIDNLKQKFKVKTFIELLKSIFKISGAA 151 Chlamydia trachomatis
15832975  70 ----FKAMGIGWLKTIIPFLLVCMFTTILvSWFQSKMQLATEAVKLKFDSLNPVNGLKRIFGLKTVKEFVKAILYIIFFA 145 Escherichia coli O1...
730801    72 ----LAVFGIG-LKYLIPFMLLCLVCSALpALLQAGFVLATEALKPNLSALNPVEGAKKLFSMRTVKDTVKTLLYLSSFV 146 Salmonella typhimurium
15803385  70 ----FKAMGIGWLKTIIPFLLVCMFTTILvSWFQSKMQLATEAVKLKFDSLNPVNGLKRIFGLKTVKEFVKAILYIIFFA 145 Escherichia coli O1...
16799762  74 ---YSLFYLMEFGKVLMPVMVMVVIFGLMnYGVQVGILFSAKAVKPQFKRLNPANYFKRVFSVKGIVEVVKALLLITLLS 150 Listeria innocua
17549613 157 GVGWWLILHYRDDFVELPRQDLVAGMRDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKEEVRKEHRESEGD 236 Ralstonia solanacearum
17989459 160 VIVFLVFFKGNSLFTDAVATDPGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGD 239 Brucella melitensis
15895417 413 VVGYKFLMSNYGDIANLNNLMVQYIPQAYLSYVISIFRIVALIMIVIAGFDFVYNRYKYKKDMKMTKHEVKEEFKQAEGD 492 Clostridium acetobu...
16125329 159 VIAYFVLKPHVGEVRNLVGMDPAAMIPEAMKLSKGLLIAVILLLVATSAFDYFWQRMRFMNRMRMTLQEVKEEFKQSDGD 238 Caulobacter crescen...
15618242 152 LILYITLKSKVSLIIETAGVSPIITAQIFKEIFYKAVTSIGIFFLIVAILDLVYQRHNFAKELKMEKFEVKQEFKDTEGN 231 Chlamydophila pneum...
15604810 152 LILYIVLKNRVELVIETAGIPPLVTAQVFKEILYKAVTSIGIFFLVVAVIDLVYQRHSFAKELKMEKFEVKQEFKDTEGN 231 Chlamydia trachomatis
15832975 146 LEIKVFWSNHKSLLFKTLDGDIISLLSDWGEMLFLLILYCLGSMIIVLIFDFIAEYFLFMKDMKMDKQEVKREYKEQEGN 225 Escherichia coli O1...
730801   147 VAAIICWKKYKVEIFSQLNGNIVGIAVIWRELLLALVLTCLACALIVLLLDAIAEYFLTMKDMKMDKEEVKREMKEQEGN 226 Salmonella typhimurium
15803385 146 LEIKVFWSNHKSLLFKTLDGDIISLLSDWGEMLFLLILYCLGSMIIVLIFDFIAEYFLFMKDMKMDKQEVKREYKEQEGN 225 Escherichia coli O1...
16799762 151 YVAYIGFRDHLDTLISYTGQNWLYSLSQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGR 230 Listeria innocua
17549613 237 PQLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGGAPRVLAKGADMVAAKIRELGAEHKIPMLEAPP 316 Ralstonia solanacearum
17989459 240 PLVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIALKIREIAASHSIPVFEDVQ 319 Brucella melitensis
15895417 493 PEIKGKRRQRMREIVTRTMLSKVPDATVVITNPTHISVAIKYERGVDKAPTVVAKGADRTALRIKEIAKENNVPIMENKP 572 Clostridium acetobu...
16125329 239 PHIKGKRRQIQMQRSRQRMMQAVPKATVVVMNPTHYAVALKYEQGETPAPLCVAKGVDDLALKIRAVAEEHGVPVLEDPP 318 Caulobacter crescen...
15618242 232 PEIKGRRRQIAQEIAYEDSSSQVKHASTVVSNPKDIAVAIGYMPEKYKAPWIIAMGINLRAKRILDEAEKYGIPIMRNVP 311 Chlamydophila pneum...
15604810 232 PEIKGRRRQIAQEIAYEDTSSQIKHASAVVSNPKDIAVAIGYMPEKYKAPWIIAMGVNLRAKRIIAEAEKYGVPIMRNVP 311 Chlamydia trachomatis
15832975 226 PEIKSKRRERHQEILSEQLKSDVSNSRLMIANPTHIAIGIYFKPHLSPIPLISVRETNEVALAVRKYAKEIGIPIITDKK 305 Escherichia coli O1...
730801   227 PEVKSKRREVHMEILSEQVKSDIENSRLIVANPTHITIGIYFKPELMPIPMISVYETNQRALAVRAYAEKVGVPVIVDIK 306 Salmonella typhimurium
15803385 226 PEIKSKRRERHQEILSEQLKSDVSNSRLMIANPTHIAIGIYFKPHLSPIPLISVRETNEVALAVRKYAKEIGIPIITDKK 305 Escherichia coli O1...
16799762 231 PEVKQRQRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPKLLVKGEDELALFIRQVADTDGVPMITNRQ 310 Listeria innocua
17549613 317 LARALYRHTEIGHQIPAALYAAVAEVLAYVYQLRRVRTHGGRAPVR 362 Ralstonia solanacearum
17989459 320 LARALYKQVNVDQMIAPEFYKAVAELIRIINTRR---AIS------ 356 Brucella melitensis
15895417 573 LARLIFKKVEVDEQIPAEMYQTVAEILALVYKLN---KKQG----- 610 Clostridium acetobutylicum
16125329 319 LARALYASVEIDEEIPVEHFEAVAKVISFILNGKKPQPRARPL--- 361 Caulobacter crescentus CB15
15618242 312 LAHQLLDEGKELKFIPESTYEAIGEILLYITSLNAQNPNNKNTNQP 357 Chlamydophila pneumoniae CWL029
15604810 312 LAHQLLDEGKELKFIPETTYEAVGEILLYITSLNAQNLENKNINQF 357 Chlamydia trachomatis
15832975 306 LARKIYATHRRYDYVSFENIDEILRLLLWLEDVENAGQPVPDEQLS 351 Escherichia coli O157:H7
730801   307 LARSLFKTHRRYDLVSLEEIDEVLRLLVWLEEVENAGKDVIQPQEN 352 Salmonella typhimurium
15803385 306 LARKIYATHRRYDYVSFENIDEILRLLLWLEDVENAGQPVPDEQLS 351 Escherichia coli O157:H7 EDL933
16799762 311 LARSIYYTTNPDEYIQEDLYKDVIEVMKELMDA-----DKIKF--- 348 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap