Conserved Protein Domain Family
FlhB

?
COG1377: FlhB 
Flagellar biosynthesis protein FlhB [Cell motility]
Statistics
?
PSSM-Id: 224295
View PSSM: COG1377
Aligned: 32 rows
Threshold Bit Score: 383.885
Threshold Setting Gi: 730801
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549613   1 MSEDSDLEKTEPASARRLEQAREEGDVPQSRELVSFVLLATGALGLWVMG-ESIVRTASSFLARCLEFH-RYDYTRAQE- 77
gi 17989459   2 ADDADKESKTEEATEQKIRDALDKGNMPFSREAPILAGIAS-FLVIAVFVaAPAATRLAVFLRELIDRP-EDWLLNSAEd 79
gi 15895417 256 gLIFADSDKTEEATPKRKSEARKKGQVARSKEVPLAATLVAITFIISLGG-QTFFNGLGVMMQTFFQSYiHSNLTELD-- 332
gi 16125329   2 ADDTDPESKTEEPSAKKLSDARAKGDVIKSADIPQLASLAGAVSVILLAG-GWLTRDLMAALTPFIAHA-GTIDLSSGG- 78
gi 15618242   1 -----MGEKTEKATPKRLRDARKKGQVAKSQDFPSAVTFIVSMFTAFSLS-TFFFKHLGGFLVSMLSQ--APTRHDPVI- 71
gi 15604810   1 -----MGEKTEKATPKRLRDARKKGQVAKSQDFPSAITFIVSMFLTFSLA-SFFAKHLGSFLVSIFKT--APQNHDPHL- 71
gi 15832975   1 -----MANKTEKPTQKKLQDASKKGQILKSRDLTVSVIMLVGTLYLGYVF---DVHHIMSILEYILDHN-AKPDIWDY-- 69
gi 730801     1 ----MSSNKTEKPTKKRLEDSAKKGQSFKSKDLIIACLTLGGIAYLVSYG---SFNEFMGIIKIIIADN-FDQSMADYS- 71
gi 15803385   1 -----MANKTEKPTQKKLQDASKKGQILKSRDLTVSVIMLVGTLYLGYVF---DVHHIMSILEYILDHN-AKPDIWDY-- 69
gi 16799762   1 ---MAKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLLIVAGLLYFFG-EMFIKNTIKAFVALLKQP--PKLASMES- 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549613  78 QWQYVGAQFGPLAMVLAGLILMLVLAALS-PLALTRGAVSFKPLTPDITRLIGMHGLKRMFSVQGLLELPRLLAKLVLVG 156
gi 17989459  80 ATRLFSVLALAVGAALVPVFIIIPLAGIAaSAFQNAPRFVGERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAAS 159
gi 15895417 333 LRRIIIFVILNAGKFIFMFGVPVMVVGIVaNIAQTGWITTTEPIKPDLKKLNPISGFKRIFSMTTIVNLLKDLVVVAVLS 412
gi 16125329  79 AMIVLKQALLAALPALVLVMVVTAFAGAAaHIAQTGFLLTPEKIKPDFQKLDLIKGLGRIFGPDGMVQFLKSAVKFLLTG 158
gi 15618242  72 TLFYLKNCLMLILTASLPLLGAVAVVGVIvGFLIVGPTFSTEVFKPDIKKFNPIENIKQKFKIKTLIELIKSILKIFGAA 151
gi 15604810  72 AVYYLKNCLILILTVSLPLLGAVGFVGLLiGFLIVGPTFSTEVFKPDLKKFNPIDNLKQKFKVKTFIELLKSIFKISGAA 151
gi 15832975  70 ----FKAMGIGWLKTIIPFLLVCMFTTILvSWFQSKMQLATEAVKLKFDSLNPVNGLKRIFGLKTVKEFVKAILYIIFFA 145
gi 730801    72 ----LAVFGIG-LKYLIPFMLLCLVCSALpALLQAGFVLATEALKPNLSALNPVEGAKKLFSMRTVKDTVKTLLYLSSFV 146
gi 15803385  70 ----FKAMGIGWLKTIIPFLLVCMFTTILvSWFQSKMQLATEAVKLKFDSLNPVNGLKRIFGLKTVKEFVKAILYIIFFA 145
gi 16799762  74 ---YSLFYLMEFGKVLMPVMVMVVIFGLMnYGVQVGILFSAKAVKPQFKRLNPANYFKRVFSVKGIVEVVKALLLITLLS 150
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549613 157 GVGWWLILHYRDDFVELPRQDLVAGMRDTMHVAGVAFLCMAGVMLLVAAVDVPLALWQYARKHRMTKEEVRKEHRESEGD 236
gi 17989459 160 VIVFLVFFKGNSLFTDAVATDPGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHWRQELRMTRQEVKDELKQSEGD 239
gi 15895417 413 VVGYKFLMSNYGDIANLNNLMVQYIPQAYLSYVISIFRIVALIMIVIAGFDFVYNRYKYKKDMKMTKHEVKEEFKQAEGD 492
gi 16125329 159 VIAYFVLKPHVGEVRNLVGMDPAAMIPEAMKLSKGLLIAVILLLVATSAFDYFWQRMRFMNRMRMTLQEVKEEFKQSDGD 238
gi 15618242 152 LILYITLKSKVSLIIETAGVSPIITAQIFKEIFYKAVTSIGIFFLIVAILDLVYQRHNFAKELKMEKFEVKQEFKDTEGN 231
gi 15604810 152 LILYIVLKNRVELVIETAGIPPLVTAQVFKEILYKAVTSIGIFFLVVAVIDLVYQRHSFAKELKMEKFEVKQEFKDTEGN 231
gi 15832975 146 LEIKVFWSNHKSLLFKTLDGDIISLLSDWGEMLFLLILYCLGSMIIVLIFDFIAEYFLFMKDMKMDKQEVKREYKEQEGN 225
gi 730801   147 VAAIICWKKYKVEIFSQLNGNIVGIAVIWRELLLALVLTCLACALIVLLLDAIAEYFLTMKDMKMDKEEVKREMKEQEGN 226
gi 15803385 146 LEIKVFWSNHKSLLFKTLDGDIISLLSDWGEMLFLLILYCLGSMIIVLIFDFIAEYFLFMKDMKMDKQEVKREYKEQEGN 225
gi 16799762 151 YVAYIGFRDHLDTLISYTGQNWLYSLSQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKDEMKDSEGR 230
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17549613 237 PQLKGRIRAMQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEQEGGAPRVLAKGADMVAAKIRELGAEHKIPMLEAPP 316
gi 17989459 240 PLVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFSVALRYKPNEDAAPVVVAKGQDLIALKIREIAASHSIPVFEDVQ 319
gi 15895417 493 PEIKGKRRQRMREIVTRTMLSKVPDATVVITNPTHISVAIKYERGVDKAPTVVAKGADRTALRIKEIAKENNVPIMENKP 572
gi 16125329 239 PHIKGKRRQIQMQRSRQRMMQAVPKATVVVMNPTHYAVALKYEQGETPAPLCVAKGVDDLALKIRAVAEEHGVPVLEDPP 318
gi 15618242 232 PEIKGRRRQIAQEIAYEDSSSQVKHASTVVSNPKDIAVAIGYMPEKYKAPWIIAMGINLRAKRILDEAEKYGIPIMRNVP 311
gi 15604810 232 PEIKGRRRQIAQEIAYEDTSSQIKHASAVVSNPKDIAVAIGYMPEKYKAPWIIAMGVNLRAKRIIAEAEKYGVPIMRNVP 311
gi 15832975 226 PEIKSKRRERHQEILSEQLKSDVSNSRLMIANPTHIAIGIYFKPHLSPIPLISVRETNEVALAVRKYAKEIGIPIITDKK 305
gi 730801   227 PEVKSKRREVHMEILSEQVKSDIENSRLIVANPTHITIGIYFKPELMPIPMISVYETNQRALAVRAYAEKVGVPVIVDIK 306
gi 15803385 226 PEIKSKRRERHQEILSEQLKSDVSNSRLMIANPTHIAIGIYFKPHLSPIPLISVRETNEVALAVRKYAKEIGIPIITDKK 305
gi 16799762 231 PEVKQRQRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPKLLVKGEDELALFIRQVADTDGVPMITNRQ 310
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*.
gi 17549613 317 LARALYRHTEIGHQIPAALYAAVAEVLAYVYQLRRVRTHGGRAPVR 362
gi 17989459 320 LARALYKQVNVDQMIAPEFYKAVAELIRIINTRR---AIS------ 356
gi 15895417 573 LARLIFKKVEVDEQIPAEMYQTVAEILALVYKLN---KKQG----- 610
gi 16125329 319 LARALYASVEIDEEIPVEHFEAVAKVISFILNGKKPQPRARPL--- 361
gi 15618242 312 LAHQLLDEGKELKFIPESTYEAIGEILLYITSLNAQNPNNKNTNQP 357
gi 15604810 312 LAHQLLDEGKELKFIPETTYEAVGEILLYITSLNAQNLENKNINQF 357
gi 15832975 306 LARKIYATHRRYDYVSFENIDEILRLLLWLEDVENAGQPVPDEQLS 351
gi 730801   307 LARSLFKTHRRYDLVSLEEIDEVLRLLVWLEEVENAGKDVIQPQEN 352
gi 15803385 306 LARKIYATHRRYDYVSFENIDEILRLLLWLEDVENAGQPVPDEQLS 351
gi 16799762 311 LARSIYYTTNPDEYIQEDLYKDVIEVMKELMDA-----DKIKF--- 348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap