Conserved Protein Domain Family
COG1365

?
COG1365: COG1365 
Predicted ATPase, PP-loop superfamily [General function prediction only]
Statistics
?
PSSM-Id: 224284
View PSSM: COG1365
Aligned: 5 rows
Threshold Bit Score: 333.699
Threshold Setting Gi: 14521917
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15678299  64 LREKLGVGRVHVEAETDIIIRrhrvglALERISELEGSFRVLKILEEALKMRMEYPsgleflLELSRSGADG-PEVAVAL 142 Methanothermobacter...
15669834   1 MNFEKIIEEKVNQKLKELRLKn-----SLEILEKLDINTELKEALKSTLLKRLNGE------KEFYKISIDKkPKAVVAF 69  Methanocaldococcus ...
20094941   1 MVVQAWTDLKVRLLRLDASRE------ILERYSRRQPELEGVLRGIEIEKARLHGElpwdywERWEGEEPRD-MRITVAA 73  Methanopyrus kandle...
14521917   1 -MLPRARG-FVEEFRLKASLR------ALERVKEFIEPK-AYERLRDLVECRLTGK-------EFERDKIN--VKIAVAY 62  Pyrococcus abyssi
14591685   1 -MLPVARGDFIREFRLRASLR------ALERVKDYLGEK-VYTRLRELLYYRLEGK-------EFPRGKID--FKMAVAY 63  Pyrococcus horikoshii
15678299 143 SGGVDSsfsliAAVKLGLRPFA-----LTVDPGTIILPGHIRRSLEELCSLLGVRHEYIGAELGDIQSGALD-GRFHPCG 216 Methanothermobacter...
15669834  70 SGGVDS-----STSAIIAKQIFdv--kAVSCYSKYIMTDEMRENAKNIAKKIGISLEFVSIDLEEVYKGVVN-GKFHPCG 141 Methanocaldococcus ...
20094941  74 SGGYDS-----TASAIILRKLGyevesVTVDPGPMFLPPKLRRNVEILSEYLGTEPKFVEEDLSDVVEGALNeGRFHPCG 148 Methanopyrus kandle...
14521917  63 SGGSDS-----SATVKILRWAG-----FDVVPITARLP-HISKEKLREETLFVEVPGYLEEMEKLIEK------RAPICG 125 Pyrococcus abyssi
14591685  64 SGGSDS-----SATVKILRWAG-----FDVIPITAKLP-QIDWSKLEEETVFVEVPGYMEEMKRLIEK------RAPICG 126 Pyrococcus horikoshii
15678299 217 RCSGLIESTVMDKIRNMEIDTVIFGDLLSTGYQSVNVDDGILRVNLPALFAASKQEVRSVASLHGVRS-SMNFGCPLLGE 295 Methanothermobacter...
15669834 142 RCHKVIENAVIDYAKKIDAEFVIFGDLLAFGYLALYREDEIFRFNLPSFFALTKDEEREILKNNGIEL-KMSYGCPLLKI 220 Methanocaldococcus ...
20094941 149 RCNAKIRKRVMG---EADTDVVAFGDGLPTGHHCVQPEDDRFKLHVPAALAKTKFELRRLVEEVLPEFhDYKYACPFLHQ 225 Methanopyrus kandle...
14521917 126 RCHSMVMRAVEEKVRELKIRILATGDMLSIGSGSIYEKENLVILNLPAFLSLNKVDLLSILGWEDY---EFKYGCPLWRE 202 Pyrococcus abyssi
14591685 127 RCHSMVMQTVERKARELGIKVLATGDMLSVGSGSIYYKDGIIILNLPAFLALSKPELLDILNWKKY---ELKFGCPLWRE 203 Pyrococcus horikoshii
15678299 296 VHRRHPHLRRYSIQRVLRETRAGVLEPGEALDLIWSICSP 335 Methanothermobacter thermautotrophicus str. Delta H
15669834 221 YHKHNKGYK-FTIQRILREVRGRVVNEEEGFKNIVEILNQ 259 Methanocaldococcus jannaschii
20094941 226 VHQRHPHLRRASIQRVLRELRHGFLEVGEALKAVYDILGG 265 Methanopyrus kandleri AV19
14521917 203 AVKRVPIMKRFAIQRVLRELRTGAINEDIAKKLIFDILRA 242 Pyrococcus abyssi
14591685 204 AVKKVPIMKRFAIQRILREVRAGVLPRDMARELIMDVLKS 243 Pyrococcus horikoshii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap