Conserved Protein Domain Family
CheR

?
COG1352: CheR 
Methylase of chemotaxis methyl-accepting proteins [Cell motility, Signal transduction mechanisms]
Statistics
?
PSSM-Id: 224271
View PSSM: COG1352
Aligned: 44 rows
Threshold Bit Score: 185.176
Threshold Setting Gi: 15639355
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20092349  286 EDAMKKIFNLVFTHTGHD-FSHYKRGTISRRVERRMVVHNIGN-------IEEYVNYLEQN---SLEVEALFRDFLINVT 354  Methanosarcina ac...
15595015  196 KNDFSNKVSSKNDGNNENsTLNNTAAFNLENIKKNLLKYSFNAslvndvfLEKVGVKFNMVdtdYLPCDSFLNEFYSKSS 275  Lyme disease spir...
7404332     1 MDTYSVFTTKWKQLTGVD-LTLYKEAQMKRRLTSLYEKKGFQS-------FKDFAAALEKD---QALLNETLDRMTINVS 69   Bacillus subtilis
15895489    4 gefknWVLKD----FGLD-LFAYKENQLHRRILSLISRVGASS-------IDEYVSMLKKD---PEQRQRFLDFITINVT 68   Clostridium aceto...
20090837  273 EDAMKKIFNLVFAHTSHD-FSHYKKGTIVRRVERRMAVHNIKK-------IDEYVDYLEQK---PAEVEALFRDFLISVT 341  Methanosarcina ac...
16264244  204 DDMIGRILAHVRGRTGHD-FSQYKRATILRRIGRRAQIARRET-------FADYYNYLREN---PEEAQALFSDFLISVT 272  Sinorhizobium mel...
9296960    26 QEEFEWFVKEVEKRFGLN-LSSYKPQRVKRRTELLLRKYNVG--------YREYLNMLIKD---KKYLDEFMDKMTINVT 93   Thermotoga maritima
17229208  160 TDSLSIIFSLLRAATGVD-FTYYKQTTLKRRIQRRMMLYKLEK-------LEDYAQYLQNN---QAEVLALYQDLLIKVT 228  Nostoc sp. PCC 7120
17229340   10 DIEIKLLLEGVYQYYGHD-FRNYAVSSLKRRIYSFMRLEGVDN-------ISALQEQLLHD---RTCLERFLLSLTVNVT 78   Nostoc sp. PCC 7120
20137857    6 EKDYLYFTRVVKRDLGLD-LTLYKETQMKRRILSFIVKKKYIT-------FGEFFKHLKKD---ALLLDEFISLITINVS 74   Listeria innocua
20092349  355 SFFRNPDAFDVLKEKIIPNLFIDKLVd-ESIRIWVPGCSTGEEAYSIGILIQEHMDLlKQPFKVQIFATDIDAHAIEQAR 433  Methanosarcina ac...
15595015  276 GNLWGADCLEEFKNEIVESRLSFMNNlnSIFNVLEIGCGSGKETMALANALSEYYVK-----PFKLTAIDNDLSKVVETS 350  Lyme disease spir...
7404332    70 EFYRNYKRWEVLETAILP-LIKTSR----PLKIWSAACSTGEEPYTLAMLLDQQKGL----PGYQILATDIDEKALEKAK 140  Bacillus subtilis
15895489   69 EFFRNPEIFREAEKEIKN-MLYSSKE---PLKIWSAACSIGAEPYSIAIILDKLDSL----RKNNIIATDIDSTILNKAK 140  Clostridium aceto...
20090837  342 NFFRNPKAFDAFQKKIIPNLFVGKYAg-ESIRVWVPGCSTGEEAYSIGILLQEHMEAlKQTFNVQIFATDIDSQAIEEAR 420  Methanosarcina ac...
16264244  273 TFFRDPSAFEALAERVIPQLFDGKEVa-DAIRVWIPGCATGEETYTMGMLLIEEAARrDLSPEIQVFGSDLDEQALRIAR 351  Sinorhizobium mel...
9296960    94 EFFRNPEKWWELRDEIIP-LIAKNSL---RMKFWSAGCSSGEEPYSLAILVHELNLS----YKTRILATDIDIGVLRRAQ 165  Thermotoga maritima
17229208  229 GFFRDPEAFEALKTNVFPIITKNRTPd-SPIRIWVAGCSTGEEAYSMAICLLEFLADkVANTPINIFATDINEVAIEKAR 307  Nostoc sp. PCC 7120
17229340   79 SMFRDPSFYLAFRNQVVPILR--TYP---FIRIWHAGCSSGEEVYSMAILLQEENLY----HRCRIYATDTNEKVLQNAK 149  Nostoc sp. PCC 7120
20137857   75 AFFRNRNRWDVLEKQVIPRLLEDSRG---KLRVWSAACSSGEEPYSLAIMMERSVGT----RHYDILATDLEPAILKRAV 147  Listeria innocua
20092349  434 IGAYPASIS-VDVSKERL---GRFFTQGPDG---SYRVQKVIRDMVIFSDHDLIKDPPFSK-LDLVSCRNVLIYMDGELQ 505  Methanosarcina ac...
15595015  351 RLVFS--ESeIGISEIYS---RNSFEQSPG----VYKFKSEILSNVLFEYSDALFSD-LPDnLGMVFLKDVLCFLDSKDQ 420  Lyme disease spir...
7404332   141 KGVYQERSL-QEVPLSMK---DRYFTQNANR---SYEVKTEIKKNITFKKHNLLADR-YEQdFDLIVCRNVFIYFTESAK 212  Bacillus subtilis
15895489  141 LGEYTENEI-KNVEKQDL---DKYFRIVGD----KYIIVDKIKKMITFKKHDLILDS-YDNnFDLVICRNVVIYFNQDVK 211  Clostridium aceto...
20090837  421 IGTYPPSIS-VDVSEERL---ERFFTQGPDG---NYRIRKNIRDMVIFSEHDLVKDPPFSK-LDLLSCRNVLIYMDGELQ 492  Methanosarcina ac...
16264244  352 EGRYPSTIE-SDLSEERL---RRFFQREGD----HYRVRRELRDVVLFASHSLLRDPPFSH-LDMISCRNLLIYLDRQLQ 422  Sinorhizobium mel...
9296960   166 EGIYEERAF-VSTPKEYL---EKYFEKLPDG---RYRIKDSVKKIVEFKRHDLLKDP-FEKnFDLIVCRNVVIYFEPEAK 237  Thermotoga maritima
17229208  308 IGVYKPSEV-ADVSPERL---QRFFVQVEG----GYQISKPVRELCIFARQNLISDPPFSR-LDLITCRNVLIYLGATVQ 378  Nostoc sp. PCC 7120
17229340  150 SGIFPLKMMqEYTQLYLKaggKQSFSEYYTAaydHAIFRASLRENIIFAQHNLATDS-SFNeFNVIFCRNVLIYFNQILQ 228  Nostoc sp. PCC 7120
20137857  148 IGEYQSRQM-EELNEQER---RSAFIEKG-D---TYQILPEYRKAIRFRRHDLLTDY-YEKgFDLIVCRNVLIYFTAEGK 218  Listeria innocua
20092349  506 KRLIPIFHYALNPGKFLFLGTSENVYG--FTNLFDTLDRKAKLYKSRKS 552  Methanosarcina acetivorans C2A
15595015  421 ILILNIIASKAIKGALLVLGDNEELKNn-DVFIKEKSTKYFNLYRKV-- 466  Lyme disease spirochete
7404332   213 EELYLKMAHSLKKNGVLFVGSTEQIFN---PEKFGLVPADTFFYQKKID 258  Bacillus subtilis
15895489  212 EKIYKKFSQSLKKGGLLFVGATESIYN---YKEYGFEKASTFIYRKL-- 255  Clostridium acetobutylicum
20090837  493 KRLIPLFYYALNPGKFLFLGSSETVNG--FMNLFDTLDRKAKLYQskpn 539  Methanosarcina acetivorans C2A
16264244  423 QQVCNTFHYALNAGGFLFLGSSESAD---HPGLFLTVDREARIYRAVAG 468  Sinorhizobium meliloti
9296960   238 NELYRKFAESLKPGGFLFVGNTERIFN---YKELGFEIYKPFIYRKVK- 282  Thermotoga maritima
17229208  379 KKLLPIFHYGLKSTGFLMLGTSETVGE--FFDLFNLVDRKNKIYS-RKI 424  Nostoc sp. PCC 7120
17229340  229 KRVHTLFHNSLCSFGILGLGKQESIRFtpYEQYYEEIAKGEKLYRRLN- 276  Nostoc sp. PCC 7120
20137857  219 HQAYQKFADSLRRGGVLFIGGSEQILN---PADYGLATLNNFFYIKT-- 262  Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap