Conserved Protein Domain Family
BetT

?
COG1292: BetT 
Choline-glycine betaine transporter [Cell wall/membrane/envelope biogenesis]
Statistics
?
PSSM-Id: 224211
View PSSM: COG1292
Aligned: 37 rows
Threshold Bit Score: 310.369
Threshold Setting Gi: 15965460
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114921     4 LSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGRTLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLG 83
gi 15829297   1 MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLG 80
gi 3025147    1 ---------------------------------------------------------MVLLAMGLVIYLATSKYGNIRLG 23
gi 3025147    1 ---------------------------------------------------------MVLLAMGLVIYLATSKYGNIRLG 23
gi 3025147    1 ---------------------------------------------------------MVLLAMGLVIYLATSKYGNIRLG 23
gi 15928201   1 ---MKKEKVMDWTTFIGTVAVLLFAVIPMMAFPKASEDIITGINSAISDSIGSIYLFMGLAIFCFVMYIAFGKYGNVTLG 77
gi 16763464   1 MKNEKKKSGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLG 80
gi 15639100   1 ----MQKEKCDFSVSLIPLGIVISCALLFISFPDISHRVIGTLLNILVNKLGFFYILTGLFFLGTTLTIAFSRYGAVYLG 76
gi 15799723   1 MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLG 80
gi 2506219    1 MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114921    84 PEQSKPEFSLLSWAAMLFAAGIGIDLMFFSVAEPVTQYMQPPEGAG--QTIEAARQAMVWTLFHYGLTGWSMYALMGMAL 161
gi 15829297  81 --NEPPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPPFGLEp-NSTGAKELGLAYSLFLWGPLPWATYSFLSVAF 157
gi 3025147   24 --EGKPEYSTLSWLFMFICAGLGSSTLYWGVAEWAYYYQTPGLNIAp-RSQQALEFSVPYSFFHWGISAWATYTLASLIM 100
gi 3025147   24 --EGKPEYSTLSWLFMFICAGLGSSTLYWGVAEWAYYYQTPGLNIAp-RSQQALEFSVPYSFFHWGISAWATYTLASLIM 100
gi 3025147   24 --EGKPEYSTLSWLFMFICAGLGSSTLYWGVAEWAYYYQTPGLNIAp-RSQQALEFSVPYSFFHWGISAWATYTLASLIM 100
gi 15928201  78 KASDKPEFNTFTWAAMLFCAGIGSDILYWGVIEWAFYYQVPPNGAKs-MSDEALQYATQYGMFHWGPIAWAIYVLPALPI 156
gi 16763464  81 --DEKPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPPFGLEp-NSTGAKEIGLAYSLFHWGPLPWATYSFLSVAF 157
gi 15639100  77 -TTRTARYSNFTWGSMIFTSTMAADILYWSLIEWAHYFTQAPFIAEhsPPTERQEWAAAYPLFHWGIIPWSFYVLLAVAF 155
gi 15799723  81 --NEPPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPPFGLEp-NSTGAKELGLAYSLFXWGPLPWATYSFLSVAF 157
gi 2506219   81 --NEPPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPPFGLEp-NSTGAKELGLAYSLFHWGPLPWATYSFLSVAF 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114921   162 GY-FSYRYNLPLT-IRSALYPIFGKR-INGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLSVLFDIP-DSMAAKAAL 237
gi 15829297 158 AYfFFVRKMEVIR-PSSTLVPLVGEKhAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIP-HTLQLDAII 235
gi 3025147  101 AYhFHVRKNKGLS-LSGIIAAITGVRpQ-GPWGKLVDLMFLIATVGALTISLVVTAATFTRGLSALTGLP-DNFTVQAFV 177
gi 3025147  101 AYhFHVRKNKGLS-LSGIIAAITGVRpQ-GPWGKLVDLMFLIATVGALTISLVVTAATFTRGLSALTGLP-DNFTVQAFV 177
gi 3025147  101 AYhFHVRKNKGLS-LSGIIAAITGVRpQ-GPWGKLVDLMFLIATVGALTISLVVTAATFTRGLSALTGLP-DNFTVQAFV 177
gi 15928201 157 GY-LVFVKKQPVYkISQACRPILKGQ-TDKFVGKVVDILFIFGLLGGAATSLALGVPLISAGIERLTGLDgKNMILRSAI 234
gi 16763464 158 AYfFFVRKMDVIR-PSSTLVPLVGEKhAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIP-HTLQLDAII 235
gi 15639100 156 GYmLHVKKRHTHK-ISEACRPLLGAY-VDGIIGEAIDICSVVGLLLGVATTFSLATPLLSLMVSLLFGIS-NTQLLALAL 232
gi 15799723 158 AYfFFVRKMEVIR-PSSTLVPLVGEKhAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIP-HTLQLDAII 235
gi 2506219  158 AYfFFVRKMEVIR-PSSTLVPLVGEKhAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIP-HTLQLDAII 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114921   238 IALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDTSFLLNALVLNVGDYVNRFMGMTLNSFAFDRPv---- 313
gi 15829297 236 ITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRMLFYTDPIAKG----- 310
gi 3025147  178 ILLSGGIFCLSSWIGINNGLQRLSKMVGWGAFLLPLLVLIVGPTEFITNSIINAIGLTTQNFLQMSLFTDPLGDG----- 252
gi 3025147  178 ILLSGGIFCLSSWIGINNGLQRLSKMVGWGAFLLPLLVLIVGPTEFITNSIINAIGLTTQNFLQMSLFTDPLGDG----- 252
gi 3025147  178 ILLSGGIFCLSSWIGINNGLQRLSKMVGWGAFLLPLLVLIVGPTEFITNSIINAIGLTTQNFLQMSLFTDPLGDG----- 252
gi 15928201 235 LLTITVIFAISSYTGLKKGIQKLSDINVWLSFVLLAFIFIIGPTVFIMETTVTGFGNMLRDFFHMATWLEPFGGIkgr-- 312
gi 16763464 236 ITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMHLPRMLFYTDAIGKG----- 310
gi 15639100 233 LCVIALVYTTAVLLGT-QGISKLSRAAVYCFSTVLVFFLCAGPTVYLIETGITAIGKMLQNFFLMATWMDPSRISlqetd 311
gi 15799723 236 ITCWIILNAICVACGLQKGVRIASDVRXYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRMLFYTDPIAKG----- 310
gi 2506219  236 ITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRMLFYTDPIAKG----- 310
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114921   314 ---EWMNNWTLFFWAWWVAWSPFVGLFLARISRGRTIRQFVLGTLIIPFTFTLLWLSVFGNSALYEIIH-GGAAFAEEAM 389
gi 15829297 311 ---GFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVMGLTASTWILWTVLGSNTLLLIDKnIINIPNLIEQ 387
gi 3025147  253 ---SFTRNWTVFYWLWWISYTPGVAMFVTRVSRGRKIKEVIWGLILGSTVGCWFFFGVMESYAIHQFINgVINVPQVLET 329
gi 3025147  253 ---SFTRNWTVFYWLWWISYTPGVAMFVTRVSRGRKIKEVIWGLILGSTVGCWFFFGVMESYAIHQFINgVINVPQVLET 329
gi 3025147  253 ---SFTRNWTVFYWLWWISYTPGVAMFVTRVSRGRKIKEVIWGLILGSTVGCWFFFGVMESYAIHQFINgVINVPQVLET 329
gi 15928201 313 ketNFPQDWTIFYWSWWLVYAPFIGLFIARISKGRRLKEVVLGTIIYGTLGCVLFFGIFGNYAVYLQISgQFNVTQYLNT 392
gi 16763464 311 ---GFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKnILNIPQLIEQ 387
gi 15639100 312 gtlGFPQRWTIFYWAYWITWSVATPFFIGAISEGRTIRNTIVGGLCWGIAGTYGSFIVLGNYGLYLQTHhLLPAAYFVRA 391
gi 15799723 311 ---GFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVMGLTASTWILWTVLGSNTLLLIDKnIINIPNLIEQ 387
gi 2506219  311 ---GFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVLGLTASTWILWTVLGSNTLLLIDKnIINIPNLIEQ 387
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114921   390 V-HPERGFYSLLAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSQLkdiNSDAPGWLRVFWSVAIGLLTLGMLMT 468
gi 15829297 388 Y-GVARAIIETWAALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREvrdGEEPPLLVRIGWSILVGIIGIVLLAL 466
gi 3025147  330 L-GGETAVQQVLMSLPAGKLFLAAYLGVMIIFLASHMDAVAYTMAATSTRNlqeGDDPDRGLRLFWCVVITLIPLSILFT 408
gi 3025147  330 L-GGETAVQQVLMSLPAGKLFLAAYLGVMIIFLASHMDAVAYTMAATSTRNlqeGDDPDRGLRLFWCVVITLIPLSILFT 408
gi 3025147  330 L-GGETAVQQVLMSLPAGKLFLAAYLGVMIIFLASHMDAVAYTMAATSTRNlqeGDDPDRGLRLFWCVVITLIPLSILFT 408
gi 15928201 393 H-GTEATIIEVVHHLPFPSLMIVLFLVSAFLFLATTFDSGSYILAAASQKKv--VGEPLRANRLFWAFALCLLPFSLMLV 469
gi 16763464 388 H-GVARAIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREvrdGEEPPLLVRIGWSVLVGIIGIVLLAL 466
gi 15639100 392 GnTPAEVIIAIIQTLPCAYIVMALLAATMIAFYASTFDALTLIIASYSQKSvapGEEPRQIMKSFWAVACILLPASLIFS 471
gi 15799723 388 Y-GVARAIIETWAXLPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREvrdGEEPPLLVRIGWSILVGIIGIVLLAL 466
gi 2506219  388 Y-GVARAIIETWAALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREvrdGEEPPLLVRIGWSILVGIIGIVLLAL 466
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114921   469 NG---ISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRres-anRDtaprplglqdrlswkKRLSRLMNYPGTRYTK 544
gi 15829297 467 GG---LKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD--------------------------------------- 504
gi 3025147  409 GAs--LETMKTTVVLTALPFLVILLVKVGGFIRWLKQDYADipahqvEHyl-----------pqTPVEALEKTPVLPAGT 475
gi 3025147  409 GAs--LETMKTTVVLTALPFLVILLVKVGGFIRWLKQDYADipahqvEHyl-----------pqTPVEALEKTPVLPAGT 475
gi 3025147  409 GAs--LETMKTTVVLTALPFLVILLVKVGGFIRWLKQDYADipahqvEHyl-----------pqTPVEALEKTPVLPAGT 475
gi 15928201 470 GGeraLEVLKTASILASVPLIVIFIFMMISFLIILGRDR---------------------------IKLETRAEKLKEVE 522
gi 16763464 467 GG---LKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDk-------------------------------------- 505
gi 15639100 472 QSt--LMHLKSLAIIAAFPLALIMLCVVASFFKELRAEVTS--------------------------------------- 510
gi 15799723 467 GG---LKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD--------------------------------------- 504
gi 2506219  467 GG---LKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD--------------------------------------- 504
                       570
                ....*....|....*...
gi 114921   545 QMMETVCYPAMEEVAQEL 562
gi 15829297     ------------------
gi 3025147  476 VFKGDN------------ 481
gi 3025147  476 VFKGDN------------ 481
gi 3025147  476 VFKGDN------------ 481
gi 15928201 523 RRSLRIVQVSEEEQDDNL 540
gi 16763464     ------------------
gi 15639100     ------------------
gi 15799723     ------------------
gi 2506219      ------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap