Conserved Protein Domain Family
BetT

?
COG1292: BetT 
Choline-glycine betaine transporter [Cell wall/membrane/envelope biogenesis]
Statistics
?
PSSM-Id: 224211
View PSSM: COG1292
Aligned: 37 rows
Threshold Bit Score: 310.369
Threshold Setting Gi: 15965460
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
114921     4 LSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGRTLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLG 83  Escherichia coli
15829297   1 MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLG 80  Escherichia coli O1...
3025147    1 ---------------------------------------------------------MVLLAMGLVIYLATSKYGNIRLG 23  Escherichia coli
3025147    1 ---------------------------------------------------------MVLLAMGLVIYLATSKYGNIRLG 23  Escherichia coli
3025147    1 ---------------------------------------------------------MVLLAMGLVIYLATSKYGNIRLG 23  Escherichia coli
15928201   1 ---MKKEKVMDWTTFIGTVAVLLFAVIPMMAFPKASEDIITGINSAISDSIGSIYLFMGLAIFCFVMYIAFGKYGNVTLG 77  Staphylococcus aure...
16763464   1 MKNEKKKSGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLG 80  Salmonella typhimur...
15639100   1 ----MQKEKCDFSVSLIPLGIVISCALLFISFPDISHRVIGTLLNILVNKLGFFYILTGLFFLGTTLTIAFSRYGAVYLG 76  Treponema pallidum
15799723   1 MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLG 80  Escherichia coli O1...
2506219    1 MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLG 80  Escherichia coli
114921    84 PEQSKPEFSLLSWAAMLFAAGIGIDLMFFSVAEPVTQYMQPPEGAG--QTIEAARQAMVWTLFHYGLTGWSMYALMGMAL 161 Escherichia coli
15829297  81 --NEPPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPPFGLEp-NSTGAKELGLAYSLFLWGPLPWATYSFLSVAF 157 Escherichia coli O1...
3025147   24 --EGKPEYSTLSWLFMFICAGLGSSTLYWGVAEWAYYYQTPGLNIAp-RSQQALEFSVPYSFFHWGISAWATYTLASLIM 100 Escherichia coli
3025147   24 --EGKPEYSTLSWLFMFICAGLGSSTLYWGVAEWAYYYQTPGLNIAp-RSQQALEFSVPYSFFHWGISAWATYTLASLIM 100 Escherichia coli
3025147   24 --EGKPEYSTLSWLFMFICAGLGSSTLYWGVAEWAYYYQTPGLNIAp-RSQQALEFSVPYSFFHWGISAWATYTLASLIM 100 Escherichia coli
15928201  78 KASDKPEFNTFTWAAMLFCAGIGSDILYWGVIEWAFYYQVPPNGAKs-MSDEALQYATQYGMFHWGPIAWAIYVLPALPI 156 Staphylococcus aure...
16763464  81 --DEKPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPPFGLEp-NSTGAKEIGLAYSLFHWGPLPWATYSFLSVAF 157 Salmonella typhimur...
15639100  77 -TTRTARYSNFTWGSMIFTSTMAADILYWSLIEWAHYFTQAPFIAEhsPPTERQEWAAAYPLFHWGIIPWSFYVLLAVAF 155 Treponema pallidum
15799723  81 --NEPPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPPFGLEp-NSTGAKELGLAYSLFXWGPLPWATYSFLSVAF 157 Escherichia coli O1...
2506219   81 --NEPPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPPFGLEp-NSTGAKELGLAYSLFHWGPLPWATYSFLSVAF 157 Escherichia coli
114921   162 GY-FSYRYNLPLT-IRSALYPIFGKR-INGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLSVLFDIP-DSMAAKAAL 237 Escherichia coli
15829297 158 AYfFFVRKMEVIR-PSSTLVPLVGEKhAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIP-HTLQLDAII 235 Escherichia coli O1...
3025147  101 AYhFHVRKNKGLS-LSGIIAAITGVRpQ-GPWGKLVDLMFLIATVGALTISLVVTAATFTRGLSALTGLP-DNFTVQAFV 177 Escherichia coli
3025147  101 AYhFHVRKNKGLS-LSGIIAAITGVRpQ-GPWGKLVDLMFLIATVGALTISLVVTAATFTRGLSALTGLP-DNFTVQAFV 177 Escherichia coli
3025147  101 AYhFHVRKNKGLS-LSGIIAAITGVRpQ-GPWGKLVDLMFLIATVGALTISLVVTAATFTRGLSALTGLP-DNFTVQAFV 177 Escherichia coli
15928201 157 GY-LVFVKKQPVYkISQACRPILKGQ-TDKFVGKVVDILFIFGLLGGAATSLALGVPLISAGIERLTGLDgKNMILRSAI 234 Staphylococcus aure...
16763464 158 AYfFFVRKMDVIR-PSSTLVPLVGEKhAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIP-HTLQLDAII 235 Salmonella typhimur...
15639100 156 GYmLHVKKRHTHK-ISEACRPLLGAY-VDGIIGEAIDICSVVGLLLGVATTFSLATPLLSLMVSLLFGIS-NTQLLALAL 232 Treponema pallidum
15799723 158 AYfFFVRKMEVIR-PSSTLVPLVGEKhAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIP-HTLQLDAII 235 Escherichia coli O1...
2506219  158 AYfFFVRKMEVIR-PSSTLVPLVGEKhAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIP-HTLQLDAII 235 Escherichia coli
114921   238 IALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDTSFLLNALVLNVGDYVNRFMGMTLNSFAFDRPv---- 313 Escherichia coli
15829297 236 ITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRMLFYTDPIAKG----- 310 Escherichia coli O1...
3025147  178 ILLSGGIFCLSSWIGINNGLQRLSKMVGWGAFLLPLLVLIVGPTEFITNSIINAIGLTTQNFLQMSLFTDPLGDG----- 252 Escherichia coli
3025147  178 ILLSGGIFCLSSWIGINNGLQRLSKMVGWGAFLLPLLVLIVGPTEFITNSIINAIGLTTQNFLQMSLFTDPLGDG----- 252 Escherichia coli
3025147  178 ILLSGGIFCLSSWIGINNGLQRLSKMVGWGAFLLPLLVLIVGPTEFITNSIINAIGLTTQNFLQMSLFTDPLGDG----- 252 Escherichia coli
15928201 235 LLTITVIFAISSYTGLKKGIQKLSDINVWLSFVLLAFIFIIGPTVFIMETTVTGFGNMLRDFFHMATWLEPFGGIkgr-- 312 Staphylococcus aure...
16763464 236 ITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMHLPRMLFYTDAIGKG----- 310 Salmonella typhimur...
15639100 233 LCVIALVYTTAVLLGT-QGISKLSRAAVYCFSTVLVFFLCAGPTVYLIETGITAIGKMLQNFFLMATWMDPSRISlqetd 311 Treponema pallidum
15799723 236 ITCWIILNAICVACGLQKGVRIASDVRXYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRMLFYTDPIAKG----- 310 Escherichia coli O1...
2506219  236 ITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRMLFYTDPIAKG----- 310 Escherichia coli
114921   314 ---EWMNNWTLFFWAWWVAWSPFVGLFLARISRGRTIRQFVLGTLIIPFTFTLLWLSVFGNSALYEIIH-GGAAFAEEAM 389 Escherichia coli
15829297 311 ---GFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVMGLTASTWILWTVLGSNTLLLIDKnIINIPNLIEQ 387 Escherichia coli O1...
3025147  253 ---SFTRNWTVFYWLWWISYTPGVAMFVTRVSRGRKIKEVIWGLILGSTVGCWFFFGVMESYAIHQFINgVINVPQVLET 329 Escherichia coli
3025147  253 ---SFTRNWTVFYWLWWISYTPGVAMFVTRVSRGRKIKEVIWGLILGSTVGCWFFFGVMESYAIHQFINgVINVPQVLET 329 Escherichia coli
3025147  253 ---SFTRNWTVFYWLWWISYTPGVAMFVTRVSRGRKIKEVIWGLILGSTVGCWFFFGVMESYAIHQFINgVINVPQVLET 329 Escherichia coli
15928201 313 ketNFPQDWTIFYWSWWLVYAPFIGLFIARISKGRRLKEVVLGTIIYGTLGCVLFFGIFGNYAVYLQISgQFNVTQYLNT 392 Staphylococcus aure...
16763464 311 ---GFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKnILNIPQLIEQ 387 Salmonella typhimur...
15639100 312 gtlGFPQRWTIFYWAYWITWSVATPFFIGAISEGRTIRNTIVGGLCWGIAGTYGSFIVLGNYGLYLQTHhLLPAAYFVRA 391 Treponema pallidum
15799723 311 ---GFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVMGLTASTWILWTVLGSNTLLLIDKnIINIPNLIEQ 387 Escherichia coli O1...
2506219  311 ---GFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVLGLTASTWILWTVLGSNTLLLIDKnIINIPNLIEQ 387 Escherichia coli
114921   390 V-HPERGFYSLLAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSQLkdiNSDAPGWLRVFWSVAIGLLTLGMLMT 468 Escherichia coli
15829297 388 Y-GVARAIIETWAALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREvrdGEEPPLLVRIGWSILVGIIGIVLLAL 466 Escherichia coli O1...
3025147  330 L-GGETAVQQVLMSLPAGKLFLAAYLGVMIIFLASHMDAVAYTMAATSTRNlqeGDDPDRGLRLFWCVVITLIPLSILFT 408 Escherichia coli
3025147  330 L-GGETAVQQVLMSLPAGKLFLAAYLGVMIIFLASHMDAVAYTMAATSTRNlqeGDDPDRGLRLFWCVVITLIPLSILFT 408 Escherichia coli
3025147  330 L-GGETAVQQVLMSLPAGKLFLAAYLGVMIIFLASHMDAVAYTMAATSTRNlqeGDDPDRGLRLFWCVVITLIPLSILFT 408 Escherichia coli
15928201 393 H-GTEATIIEVVHHLPFPSLMIVLFLVSAFLFLATTFDSGSYILAAASQKKv--VGEPLRANRLFWAFALCLLPFSLMLV 469 Staphylococcus aure...
16763464 388 H-GVARAIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREvrdGEEPPLLVRIGWSVLVGIIGIVLLAL 466 Salmonella typhimur...
15639100 392 GnTPAEVIIAIIQTLPCAYIVMALLAATMIAFYASTFDALTLIIASYSQKSvapGEEPRQIMKSFWAVACILLPASLIFS 471 Treponema pallidum
15799723 388 Y-GVARAIIETWAXLPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREvrdGEEPPLLVRIGWSILVGIIGIVLLAL 466 Escherichia coli O1...
2506219  388 Y-GVARAIIETWAALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREvrdGEEPPLLVRIGWSILVGIIGIVLLAL 466 Escherichia coli
114921   469 NG---ISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRres-anRDtaprplglqdrlswkKRLSRLMNYPGTRYTK 544 Escherichia coli
15829297 467 GG---LKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD--------------------------------------- 504 Escherichia coli O1...
3025147  409 GAs--LETMKTTVVLTALPFLVILLVKVGGFIRWLKQDYADipahqvEHyl-----------pqTPVEALEKTPVLPAGT 475 Escherichia coli
3025147  409 GAs--LETMKTTVVLTALPFLVILLVKVGGFIRWLKQDYADipahqvEHyl-----------pqTPVEALEKTPVLPAGT 475 Escherichia coli
3025147  409 GAs--LETMKTTVVLTALPFLVILLVKVGGFIRWLKQDYADipahqvEHyl-----------pqTPVEALEKTPVLPAGT 475 Escherichia coli
15928201 470 GGeraLEVLKTASILASVPLIVIFIFMMISFLIILGRDR---------------------------IKLETRAEKLKEVE 522 Staphylococcus aure...
16763464 467 GG---LKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDk-------------------------------------- 505 Salmonella typhimur...
15639100 472 QSt--LMHLKSLAIIAAFPLALIMLCVVASFFKELRAEVTS--------------------------------------- 510 Treponema pallidum
15799723 467 GG---LKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD--------------------------------------- 504 Escherichia coli O1...
2506219  467 GG---LKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD--------------------------------------- 504 Escherichia coli
114921   545 QMMETVCYPAMEEVAQEL 562 Escherichia coli
15829297     ------------------ Escherichia coli O157:H7
3025147  476 VFKGDN------------ 481 Escherichia coli
3025147  476 VFKGDN------------ 481 Escherichia coli
3025147  476 VFKGDN------------ 481 Escherichia coli
15928201 523 RRSLRIVQVSEEEQDDNL 540 Staphylococcus aureus subsp. aureus N315
16763464     ------------------ Salmonella typhimurium LT2
15639100     ------------------ Treponema pallidum
15799723     ------------------ Escherichia coli O157:H7 EDL933
2506219      ------------------ Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap