Conserved Protein Domain Family
FlgK

?
COG1256: FlgK 
Flagellar hook-associated protein FlgK [Cell motility]
Statistics
?
PSSM-Id: 224176
View PSSM: COG1256
Aligned: 26 rows
Threshold Bit Score: 300.879
Threshold Setting Gi: 15606764
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858   4 MSMFGILNTALTGIHAHKLAMNIVGHNIANASTPGYSRQRPVIEANPPIPLTTLTQpsfplqmGTGARVKTIVRLRDAFL 83
gi 3915691    2 DSTFSGIEIGKRSLFAHKDAMNTVGHNLSNATKPGYSRQRVTMKTEIPLYAPQLNRakkqgqlGQGIVVQSIDRVKDELL 81
gi 2828498    2 TSTFMGLETARRALSAQQAALSTTANNVANANTDGYTRQRVSLEATDYFPAVSKNAektagqmGTGVQGKSVERIRDIFL 81
gi 15895480   2 PGLFGTLNIGVSGLTVNQQAIDVTGHNISNASTDGYSRQRVDIQTRSPYGMPSLNSaagpglfGTGAEVYSVQRVRDSFL 81
gi 15792783   1 MGIFGTLYTGVTGLKASEVQIATTGNNISNANATFYTRQRVVQTTNGYITTGGVQV-------GTGTAVESIVRLHDEYS 73
gi 15645733   2 GGILSSLNTSYTGLQAHQSMVDVTGNNISNASDEFYSRQRVIAKPQAAYMYGTKNV-------NMGVDVEAIERVHDEFV 74
gi 15639647   1 MSTFASIELGKRALYAHKQSVQTAGHNVSNSSTPGYSRQRVNLDSFEPLYRPDLSRaqlpgqiGQGVTIGSIARLRDQLL 80
gi 15606764   1 -MFGASFNIISQALEVYKKMIDVKNRNIANAQEENYVAE-------EPVVQSDLYS---------GITFQEVRRIQNFNF 63
gi 15612112   2 GGILSSLNTSYTGLQAHQSMVDVTGNNISNASDEFYSRQRVIAKPQAAYMYGTKNV-------NMGVDVEAIERVHDEFV 74
gi 16799788   1 -MRLSDFNTSLSGMSAAQIANMVAQQNISNMNTPGYIRQAVDQTAVYGDGGLLGGKq-----tGYGVKVTDIKRLTNAAL 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858  84 DVQYRQVNNRYNYWDTVLSNLHFIEQLLAEPG-EDGIRSLVDNFWNAFKEVMSDPSST-ASKAEVVSRAQQMVSQIKDLY 161
gi 3915691   82 NTRIIEESHRLGYWTSQDKFISILEDVYNEPE-DQSIRKRLNDFWESWHDLANQPQGL-AERKIILERGKSFCEGIRNRF 159
gi 2828498   82 DYQYRLQNNSAGYYDTKAKALSQMEGVLNETD-DSGLNSVLNSFWNSLQELSNNTNEE-SARSVVARKGQAVAETFNYIS 159
gi 15895480  82 DYQIRDLTTRNGTFKTTNNYLSEVESMFDESS-SAGISASITTFFSAIQNYTNASSATpTSIKSIISNAQTMTNQLNNIY 160
gi 15792783  74 YYKLKGASTQLEYTKYMASTLQEIAQRFPDLQn-TGILQDLENYNKAWNDFASNPNEN-ATKIALVKASQTLTESVNNTF 151
gi 15645733  75 FARYTKANYENTYYDTEFSHLKEASAYFPDID-EASLFTDLQDYFNSWKELSKNAKDS-AQKQALAQKTEALTHNIKDTR 152
gi 15639647  81 DSRIVSQTDEQGYWSTRDAYVRLLEQVYNEPE-DIAVRTRLDQFWDGWQELSVYPEAR-AARQVVLTRAQTLTDAIHHQY 158
gi 15606764  64 INTRNEKLSYVSYLEERRDYLSKLESVFQELSqGNGLIDYVNRFFQSYQELMKEPTNE-GAKSQFLESAKMLVKTIKSRY 142
gi 15612112  75 FARYTKANYENTYYDTEFSHLKEASAYFPDID-EASLFTDLQDYFNSWKELSKNAKDS-AQKQALAQKTEALTHNIKDTR 152
gi 16799788  75 TTQYNNQIAKQSASLYQSGALGQALNLFGTPG-KNTPSDNLDNFFTAWAALAKNPDQA-TNTTALLSSMSIFTDQLNQLH 152
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858 162 GRLEQLREDIDAEIVQRVSEINQMIKRLADLNNKIRTS----MMLNSPPNDLLDERDRILDELSNLANINYTEAEDGQit 237
gi 3915691  160 HSLERIYIMANDEIKITTDEANNYIRNIANLNKQISKS----QAMKDNPNDLMDARDLMVEKLGNIISVSIENKQDPN-- 233
gi 2828498  160 ESLTNVQSNLKAELNTTVLDVNSLLSQLNSLNKQIAQV----EPVGLLPNGLYDQRDLLIDKLSSMVDIKVSYNKSGG-- 233
gi 15895480 161 TQLTKLKGDVQLGINDDIISVNSMLDKIDSLNQQIITV----KQAGKEPNDLEDSRDLLLDQLSEKFGINVDSSPDFDg- 235
gi 15792783 152 ATLDKIQKKVNDDIKNTVDEINRIGEEIATINKQIYGQe---ALPTEHANELRDRRDELELTLSKLVSAVASKNEINQ-- 226
gi 15645733 153 ERLTTLQHKASEELKSVIKEVNSLGSQIAEINKRIKEVe--nNKSLKHANELRDKRDELEFHLRELLGGNVFKSSIKT-- 228
gi 15639647 159 RGLVGIRDMLNADIEATVEQVNDLLAKIAQLNEQIVKS----KAMGDNPNDLLDRRDTLVESLAHRIEVRVDVRDEDE-- 232
gi 15606764 143 GELTRSYNEIDYTINDYVRKVNELVKKIYKINKEIFFKyaqtKVRGEDYKTLLDQRDKYLKELSQYINVRAQEDELGR-- 220
gi 15612112 153 ERLTTLQHKASEELKSVIKEVNSLGSQIAEINKRIKEVe--nNKSLKHANELRDKRDELEFHLRELLGGNVFKSSIKT-- 228
gi 16799788 153 SGLKELETTIAADTDAAIQDLNSLIKKLGSINKAIGNA------GSNPPNDLLNQRDQLLSTMSGYAGISVSAHPNNPd- 225
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858 238 lriGNQIVLNGSTYRELRALERpygkgyhelfvgnsqlilsdgklkalidlrdssivkymrkldefvlfitdslnlvhrd 317
gi 3915691  234 ---EFLIHAEGRHLVQGSIANE---------------------------------------------------------- 252
gi 2828498  234 ---NALASAEGTVSIEILDKNK---------------------------------------------------------- 252
gi 15895480 236 ---EDVSVLDKVGNVNPTLVKSvgnd------------------------------------------------------ 258
gi 15792783 227 ---DNRLDTTITDPGHQYNLSIegfsi----------------------------------------------------- 250
gi 15645733 229 ---HSLTDKDSADFDESYNLNIghgfni---------------------------------------------------- 253
gi 15639647 233 ---SYVIHSAGLEVVQGKSYKT---------------------------------------------------------- 251
gi 15606764 221 ---IKVYTSKGFVLVDFSENFF---------------------------------------------------------- 239
gi 15612112 229 ---HSLTDKDSADFDESYNLNIghgfni---------------------------------------------------- 253
gi 16799788 226 ---VYDVTIGGRLVVQGDETTEit-------------------------------------------------------- 246
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858 318 gfesngvttnlnfFKKIEAFSDDPSIfrikgnrklemgpyhtvtglhsansqaeiegrrfnsndVVLSFDGGSSNVLNIS 397
gi 3915691  253 -------------FKLEATNGPTRTRw-------------------------------------NILWANNDK-----A- 276
gi 2828498  253 --------------QSLGTVLDGKNY--------------------------------------EVSELAANYDNETGLV 280
gi 15895480 259 ---------nvnrFSYIDAVVKGTDTgskn------------------------------gageEIYSYEVDYYKLGNKA 299
gi 15792783 251 --------vdginFHPLKLDYDDKNKs-------------------------------------YSIYYETPDEKVRDLT 285
gi 15645733 254 --------idgsiFHPLVVKESENKGg------------------------------------lNQVYFQSDDFKVTNIT 289
gi 15639647 252 -------------LGLVSGTTPEGYVs--------------------------------------VVWKDSGD-----R- 274
gi 15606764 240 ------------------TLKYEGGK---------------------------------------LIYEKDES----DIT 258
gi 15612112 254 --------idgsiFHPLVVKESENKGg------------------------------------lNQVYFQSDDFKLTNIT 289
gi 16799788 247 ------------sTRTATGFEFSVDG--------------------------------------QKLNMPEGSIIASVRV 276
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858 398 AGTTIGDLVGSWNLLGtslkvGTHAGGYRLyLEDSTGSLRNRLFLSLGDSLSQMGFDTETKGYITIKESDlsglssgvyn 477
gi 3915691  277 -YLKTGKLGSLLNIR------DEEIKNEINeLNNIAANIIEIVNEIHEAGRGMDKKNGRSFFSQELKLTD---------- 339
gi 2828498  281 SSISIGDTAVQAESFS-------SKGSLLGfIESYGYITADGQEKGVYPEMLSDLDNMALEFAKAFNEVHr--------- 344
gi 15895480 300 SSDNRIKLNINMTESQak--eIEQARVLMTdKNGIALSSADGKTKLDGTASSYNFSDLSLFKPVGGDINGe--------q 369
gi 15792783 286 AKISGGQLGAQLDLRGrn--ySKSEGKYEDgIIQGYMDSLDTFAKTMINETNNLYASSAKSS-VTSDYLSg--------- 353
gi 15645733 290 DKLNQGRVGALLNVYN-----DGSNGTLKG-KLQDYIDLLDSFAKGLIESTNAIYAQSASHY-IEGEPVE---------- 352
gi 15639647 275 AHFSGGKLAALIELR------DTDVRDELRkLDTMAMNFVDLVNNVHRNAMGLNGKTGLDFFKEQYFINN---------- 338
gi 15606764 259 NVVESGQIKGLIDAKG-------DIENLIN--------------------KLDNLRDYLVN------------------- 292
gi 15612112 290 DKLNQGKVGALLNVYN-----DGSNGTLKG-KLQDYIDLLDSFARGLIESTNAIYAQSASHH-IEGEPVE---------- 352
gi 16799788 277 NQNEIKSYQEKIETFS-----NGLAKALDDiQVKNVNKTMDDLQKINDALQANPNDEKLLSNREELLRQLe--------- 342
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858 478 INVEYILEDgtrqtetisvDLSSGVNLSNIEasinssshlRAQIYADPSTGEnmlvivpdeqlnFDPSAVKVLSDDDFFT 557
gi 3915691  340 DRGRYDTNGng------qfDSVHIFKINSTNeifpeeklgFYGTLKFEATNSne--------ivEIPYNAPDTVQDVINR 405
gi 2828498  345 ----------------------NGVTKSGEQ-----------GGDFFDFTGG---------------ETEPAKGAAGKIK 376
gi 15895480 370 TVQDKINGYidqmnrvaktIALAINTVSSGMvnptqsqlaSDGVHSTPSLDElp---------iFVNSDFTKDASNTTFK 440
gi 15792783 354 LKGDIPLVNyd------rtIQPGSFDIVIYDdkgdkkltkTITIDVNTTMND------------IMRQINANTDDNDNKN 415
gi 15645733 353 FNSDEAFKDtn------ynIKNGSFDLIAYNtdgkeiarkTIAITPITTMND------------IIQAINANTDDNQDNN 414
gi 15639647 339 VDGNFDRDGdg------qyDSSYIFRISGAHaldareqvgLTGVITLSAADGt----------vEVPYAATDMVADVVAR 402
gi 15606764 293 -------------------------------------------NVKIPVNGG------------------GEASVFSGAS 311
gi 15612112 353 FNSDEAFKDtn------ynIKNGSFDLIAYNtdgkeiarkTIAITPITTMND------------IIQAINANTDDNQDNN 414
gi 16799788 343 --------------------kFPGVTRSGDT----------LTIGGVDHAID-------------TLGTSTYVTDVNDFS 379
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858 558 ESNAfvrnyevlkykdtlenifygqtgfdptrpftitinstdieidpavdtletlvekinekntgvladltphhslvfra 637
gi 3915691  406 INNSnaqvtarins------------------------------------------------------------------ 419
gi 2828498  377 VAD----------------------------------------------------------------------------- 379
gi 15895480 441 PSKYfn-------------------------------------------------------------------------- 446
gi 15792783 416 SNDDvddhinasfsyd---------------------------------------------------------------- 431
gi 15645733 415 TENDfddyftagfnn----------------------------------------------------------------- 429
gi 15639647 403 INQAnaevtayldqn----------------------------------------------------------------- 417
gi 15606764 312 IN------------------------------------------------------------------------------ 313
gi 15612112 415 TENDfddyftasfnn----------------------------------------------------------------- 429
gi 16799788 380 IP------------------------------------------------------------------------------ 381
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858 638 sslydfdlrmmeikgpqgffEAVGFVdpdgdPTTFDWNTSFTLVsksddftTLSERfkvadiLTFDRAPYDEPLNIVNQF 717
gi 3915691  420 ----------egkleikavkEQEDENitfkiKHIEDSGSFLTKYtgilnasGPEGAydykniDTTDKLAPKSTYSISPLK 489
gi 2828498  380 -------------------------------SIIDSKGANIAFS------------------LTGAANDNANATKLANVL 410
gi 15895480 447 ------------------dtTNSGKNw---eDYITAGNISINPDllgtnpsLKVRAnddqygLPSENAVNGSTDQDRAIA 505
gi 15792783 432 ---------aktgdglfqinAKSGFK-----VAIEDKGTNFAGA-------FSIGG------FFSGTDASDMKVKDSILN 484
gi 15645733 430 ---------etkkfviqpknASQGLF-----VSMKDNGTNFMGA-------LKLNP------FFQGDDASNISLNKEYKK 482
gi 15639647 418 ---------hklvlkattahNSDNPDfv--iRHVEDSGRFLAGYagllaasGAEGAfdwqraDAIAALDQAGAQHAVSPI 486
gi 15606764 314 -------------------------------DFEVDANLETN----------------------LGNLDFSRTQDYAQNA 340
gi 15612112 430 ---------etkkfviqpknASQGLF-----VSMKDNGTNFMGA-------LKLNP------FFQGDDASNISLNKEYKK 482
gi 16799788 382 -------------------------------IFTQSSGKWILNP-------------------AITSNAENKPFLGVIAA 411
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642858 718 EVSsslatnpanlaVDVGYALENSDwnatsikPSGGANPELLETIQNly-tRKMLSNGKESFYEFFGGVVSELGVEAETA 796
gi 3915691  490 NPAawikv-adiidSDPSKIASGIKnptneisIGDNQAALRISSFGN----SQIMIGKNLTLNDYFANTASNIAIKGQIS 564
gi 2828498  411 TG---------------------------------KITINGKET----------------SVLDYYAGLIGELGIEAQEA 441
gi 15895480 506 LAKl----------QKVAFKIQDVNpdnytrsDFAKTLVKDTDTGVN----TIKSDPDGVTVDDYLKSFVNTLGIDNQSA 571
gi 15792783 485 DPS-----------TVRASSNGVDS-------GNDMANKIIQLQYKKvnfyNEDGTIDNLTMEEYYRKLTGKIASDGENN 546
gi 15645733 483 EPT-----------TIRPWLAPING-------NFDVANMMQQLQYDSvdfyNDKFDIKPMKISEFYQFLTGKINTDAEKS 544
gi 15639647 487 AHPagwmelnpavlSDVYSVAAGYPsaeglphAGDNRAALAIASLRN----SPVMIGNRHTFDEFFAEVTTAIGLKGEQA 562
gi 15606764 341 ------------------------------------LTWWEEAKG-------------------RTKDITNYVATQKNAL 365
gi 15612112 483 EPT-----------AIRPWLAPING-------NFDVANMMQQLQYDSvdfyNDKFDIKPMKISEFYQFLTGKINTDAEKS 544
gi 16799788 412 ----------------------------------DIASLKTDKNIQG------------TTFPSFMDGIITEVATDASKS 445
                       810       820       830       840       850       860
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15642858 797 SNLKNNTEILRQEIDNAREEVKGVSLDEEMANMIEYQHAFSAAAKVITAVDQMIQTVINMVG 858
gi 3915691  565 EITKESQSQILKDLTDLRMSISGVNKDEELANMIEFQQAFIAASKFITVSVELIDTVINKMG 626
gi 2828498  442 NRLASNTETQLNDADINRQQMSAVSLDEEMTNMIQFQHAYNAAARMVTLQDELLDKVINGMG 503
gi 15895480 572 SEGVKGSNNVLSQIKQTREATSGVSLDEEMTNLIQYSHGYQASAKIISTVDQLLDVVVNNLK 633
gi 15792783 547 NVVNSSNETLYNSVYSEYQSKSGVNTNEELAALIQYQSSYGAAAKIVSTVDQMLDTLLGLKS 608
gi 15645733 545 GRILDTKKSMLETIKKEQLSISQVSVDEEMVNLIKFQSGYAANAKVITAIDRMIDTLLGIKQ 606
gi 15639647 563 ERSMQMHAAILKELTDMRDATSGVNIDEELADIIKFQHGYNASARFIAAVNEMLDTVINRMG 624
gi 15606764 366 DSEYEVEKALYDSLEKKILERQGVSIDQEFMEIMQIQKNYEAVAKILPRIDEMFRTLLNMV- 426
gi 15612112 545 GRILDTKQSMLETIKKEQLSISQVSVDEEMVNLIKFQSGYAANAKVITAIDRMIDTLLGIKQ 606
gi 16799788 446 SATSTADTQALNSLSESKSSLEGVNIDEEMTNIMQYQSYYVANTKAMNTVNDMMKALLAML- 506
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap