Conserved Protein Domain Family
FwdA

?
COG1229: FwdA 
Formylmethanofuran dehydrogenase subunit A [Energy production and conversion]
Statistics
?
PSSM-Id: 224150
View PSSM: COG1229
Aligned: 7 rows
Threshold Bit Score: 969.259
Threshold Setting Gi: 11499514
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20089204   1 MAGTIAIKNGYVFDPLNEINGEKMDIFIRDGKVVKELSSAEMKeAKVIDASGMTVMPGGVDSHSHVAGAKVNAGRSMRPE 80
gi 11499514   2 MHHALHIKNGIVIDPKNGVKAEKMDIFVKNGKIVEESEVKGED-VKVIDANNKLVVAGGVDMHAHIAGSKINTGRTMRPE 80
gi 20089717   3 KMSEILIKNASVCDPAQGINCEPMDICIRDGKIVER--VSG-N-AKVIDAVGKLTMAGGFDGHTHSAG-KINVGRFINPN 77
gi 20092968   1 MAGTITIKNGYVFDPLNEINGEIMDIFIRDGKVVKELSAAEIKeSKIIDASGMTVMPGGVDSHSHVAGPKVNTGRMMRPE 80
gi 15669358   1 --MEYIIKNGIVYDPLNGINGEKMDICVKDGKIVES--VSDN--AKVIDASGCVVMPGGIDSHSHVAGAKVNVGRIFRPE 74
gi 20094965   1 MAKELLIKNACVYDPLNGIEGEVMDIGVKDGKIVDPSEVDESK-AKVIDAEGRLTMAGGVDIHAHVAGPKVNVGRIFRPE 79
gi 15679553   1 --MEYIIKNGFVYCPLNNVDGEKMDICVKDGKIVES--VSDS--AKVIDASGKMVMPGGVDPHSHIAGAKVNVGRMYRPE 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20089204  81 DHYK--ANLNKTA------LTHSGSGYTVPSVFKQGYDYAAMGYTTVFEAAVPPLEARHTHEEMRATPLLDMGGYLVLGN 152
gi 11499514  81 EMR---VVRNIAG------KFRAAVGRVLLTSPAIGYEYAKMGYTISIEAAQPPIGSPHTHEELDAIPMIDKAALPVFG- 150
gi 20089717  78 DARKn-PVPGLSGqvarteKTRAQVGYNTPNTYAIGYRYAKLGYTTICEAAIPLLAARHTHEEFKEIPILDKMGLSLFGS 156
gi 20092968  81 DHYK--ANLKKTS------LTHSGSGYTVPSVYKQGYDYAAMGYTTVFEPAIPPLEARHAHEEMCATPLLDMGGYLVLGN 152
gi 15669358  75 DSKR--EIYAKKG-------LRTGTGFSVPSTYKTGYQYSEMGYTTVIEAAMPPLIARHTHEEFMETPQIDKAAMPLFGN 145
gi 20094965  80 DSRRlqVAIKKLG-------TRSGTGFSVPSTTITGYLYAQMGYTTVMEAATPPLLTRHTHEEIRDTPILDEGAYTLMAN 152
gi 15679553  75 DSRR--DAEKFRA-------GRAGSGFSVPSTFMTGYRYAQMGYTTAMEAAMPPLLARHTHEEFHDTPIIDHAAYPLFGN 145
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20089204 153 NFF-LMRYIRNGDMEKAAAYVAWMMKTHKTYGIKCVNPAGVENWAWGKNVSDLDEANIHFEITPREVIKGLTEINETLGM 231
gi 11499514 151 NWHfVLKYVAEKDMEKLKAFIAWAIERTKGFGVKVVNPGGVGAWMYGGNVTSLDDQVPGFNVTPREIITSLVKATEELQL 230
gi 20089717 157 NWQ-VMEYIRDKEPEKLAAYIAWGLKASRGYGVKIVNPGGGEAWGWGRNVTGLYDPVPNFDVTPAEILIGLAEANERLRL 235
gi 20092968 153 NFF-LMHYLRDGDLERAAAYVAWMMKTHKTYGIKCVNPAGVENWGWGKNVGSLDEANIHFEITPREVIKGLAEVNERLGM 231
gi 15669358 146 NWM-VLEYLKEGDIKACAAFVAWLLKAVKGFAIKIVNPGGTEAWGWGKNVHSLDDPVPYFDITPREIVRGLAEVNELLGL 224
gi 20094965 153 NWI-LYEYIKEGELEKAAAYAAWLLRATKGFVIKMVNPGGTEAWGWGENVHSLDDPVPYFEITPAEIYQNYVKINEMLGL 231
gi 15679553 146 NWF-VMEYLKDGDVDACAAYASWLLRATKGYAIKIVNPAGTEAWGWGGNVHGIYDPAPYFDITPAEIIKGLAEVNEKLQL 224
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20089204 232 PMPVHLHANNLGHPGCYAITKDSLKIPDG--VKTRQnmdvewaetkIDPLRDRSVYLTHLMFNSFAGTTWADCESGVKDI 309
gi 11499514 231 NHSVHLHCNRLGVPGNYETTVESIKLVDG----IR-------------NDARQVLHVTHVQFNAYAGDSWRTVASGAEAI 293
gi 20089717 236 PHSIHVHCNNLGKPGNYATTIETMKLFEK----VK------------PSRDRQALHVTHVQFNAYAGTSWRDFETGAPMV 299
gi 20092968 232 PVPIHLHANNLGHPGCYTITKDSLKIPDG--VKTRQnmdvewaetkMDPSRDRSIYLAHLMFNSFGGTTWADFESKVKDI 309
gi 15669358 225 PHSIHVHPNNLGHPGNWETTLETMKCVEg--VEAKP----------RVGERETSYYNTHCQFHSYGGTSWKDFESKAIEI 292
gi 20094965 232 PHSIHIHPNLLGEPGNYEITTDSWDVIKKtgVEPNP----------EIGEREQVVHNTHVQFHSYGGDSWPTFESKAEEV 301
gi 15679553 225 PHSIHLHCNDLGHPGNYETTLASFDVPKn--IKPDP----------ATGERDTVLYATHVQFHSYGGTTWRDFVSEAPKV 292
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20089204 310 ADYINNRDHVVIDSGCVPFGEATVMTGDGPAIHDLYTLTGNKWSNTDIEMECGSGVLPFNYLKSNPVHSLQWAMGLECLL 389
gi 11499514 294 AKTVNSMDNVTIDMGQPIFGHATAMTGDAPFQFTLHKLTGSRWSNKDSEIEGGAGIVPIAYLPKNPVHALQWAIGLELGL 373
gi 20089717 300 ADYVNGADHLTFDLGQVIFGPAVTMTADGPVEYANARMLHEKWSNQDIELEDASGVVPLFYSPKSFVNAVQWAIGLELAL 379
gi 20092968 310 AGYINNKDHVVIDSGCTPFGEATSMTGDGPAIHDLYVLTGNKWSNTDVEMECGSGVIPFTYLKSNPVHSVQWAMGLECLL 389
gi 15669358 293 AEYVNKSKHVVIDVGQVTLDETTTMTADGPMEYDLHMTNGLKWANCDVELETGSGVVPFIYSPKGPVYAVQWAIGLELFL 372
gi 20094965 302 AKYLNKNDHVTVDLGAVTLDETTTMTADGPLEWELQELTGFKWANYDVELETGSGVVPFIYSPKNPVHSVQWAIGLEIAL 381
gi 15679553 293 ADYVNRNDHVVIDVGQITLDETTTMTADGPMEYDLHSLNGLKWANCDVELETGSGVVPFIYSARAPVPAVQWAIGMELFL 372
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20089204 390 LINDPWKTIMTTDSPNGGPFTKYPEVMTWIMSEAFRKQTFGE-CHKWANDRSALGGVNRELSLYDLAILTRANPAKTIGM 468
gi 11499514 374 LIDS-DKVVLTTDYPNGGPFTEYPYIMAMLMSKKMREGELER-VSPFVQKASNLPAIDTEKTLEEVIHMTRSLPARVLGL 451
gi 20089717 380 LVKDPWKIMFTTDSPNGGSFVNYPEAFTYLMSAKRRAEVISG-FSKMALDRMVLPGIDRELDFYELAVMTRSTQSKMYSR 458
gi 20092968 390 LINDPWKTIMTTDSPNGGPFTKYPEVMTWIMSEAFRKQTFGE-CHKWANDRSALGGVNRELSLYDLAILTRANPAKTIGM 468
gi 15669358 373 NTN-TDKVLLTTDHPNAGPFTRYPRVIAWLMSKKYRDEWLYNkVHKWAQQRSHVADADKEYDLYEIAKITRANQAKVLGL 451
gi 20094965 382 LTENPWQVVISTDHPNAGPFIRYPRIIAWLMSEPYREEWIEN-VHPWVGQRAAIATIDREYTWTDITITTRAAPAKMLGL 460
gi 15679553 373 LIDDPGKVCLTTDSPNAGPFTRYPRVIAWLMSNKYRMNLIEGeLHKWAQRKSTIATIDREYTFSEIAQITRVTSAKVLGL 452
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20089204 469 AHRKGSLGEGADGDVTVYNLNPQQLD-PNNYEALLRTFRKAEYTVKGGEIVAVKGEIVSLPEKRTYYSEVHVENEREKEM 547
gi 11499514 452 PQ-KGHLGVGADADIAIYDLNPLDVDtSNDFEKVYKAFKTAVYTIKDGQILVKDGELVDEYWGRTYWVDATG-KADMEAI 529
gi 20089717 459 PE-KGNLKVGSDADIAIYDLLPGQVDpSTEYAKVKQAFSGAAYTLKGGEIVVKDGEIEATPKGKTYWVNAKVPKSIDAAM 537
gi 20092968 469 AHRKGSLGEGADGDVTVYNLNPQQLD-PNNYEALLRTFRKAEYTVKGGEIVAVKGEIVSLPEKRTYYSEVHVENEREKEM 547
gi 15669358 452 SETKGHLGVGAEADIAIYAIDPE----EKDGKKIEKAFRYAKYVLKGGEVVVKDGNVVKEVFGDTIYVDVQVGEDLMNEV 527
gi 20094965 461 SDRIGHLGEGAYAHIAIYDIKPDEVDpSRDYEEVEKAMEQAWLVVKDGEIVVQEGVVVNEPVGRTYWVDVKVPEDLLEEV 540
gi 15679553 453 SETKGHLGAGADADIAVYNINPETVDpSADYMAIEEGFSRAAYVLKDGEIVVKDGEVVASPHGRTYWIDTQVDESLYNEV 532
                       570       580       590
                ....*....|....*....|....*....|....*...
gi 20089204 548 LADVKEWFR-YYTLGFANYPTPEKYLANPTPIQVNGER 584
gi 11499514 530 KDDLNEMFSkYYTVELQNYGVEERWLRKPERIVI---- 563
gi 20089717 538 QKDIDRKFRkYYTVSKANYMVEDSYIQKPVEIDTEGVF 575
gi 20092968 548 LADVKEWFR-YYTLGFANYPTPEKYLANPTPIQVNGER 584
gi 15669358 528 LKDVGEKFRrYYSVNLENYPVSDEYANSWRVIKIDATD 565
gi 20094965 541 KKDLETKFRrYYSVNLGNYQVQDVYIPKEERIVIDARD 578
gi 15679553 533 LASVESKFKqYYSVNFANYPVQDEYLPKSAPVKGVML- 569
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap