Conserved Protein Domain Family
MutY

?
COG1194: MutY 
Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs [Replication, recombination and repair]
Statistics
?
PSSM-Id: 224115
View PSSM: COG1194
Aligned: 44 rows
Threshold Bit Score: 229.538
Threshold Setting Gi: 15678524
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1723233    4 SNHSLDLHSYTqleverfRESLIQFYDKTKR-ILPWRKKECippsedspledweqpvqrLYEVLVSEIMLQQTRVETVKR 82
gi 14601039  65 LFLDKGRIEAL-------RRRLIEWYRVYGDkDLPWRNTAD------------------PWAILVAAFLLRKTTARQVVR 119
gi 15894778   1 MYISDEEIYMF-------QCFLLDWYDKNKR-NFPWRYTFD------------------PYKVLVSEILLQQTNVDKVVE 54
gi 15792925   1 --MQKKELEKL-------QENLLLWYEKNGRkTLPWRNLQSqncdes------lkhidrAYGVYISEIMLQQTQVKSVLE 65
gi 15644772   1 -------METL-------HNALLKWYEEFGRkGLPFRNLKGin---------------aPYEVYISEVMSQQTQINTVIE 51
gi 15678524   1 --------------------------------------------------------------------MLHRTRAEQVLE 12
gi 18313897   6 IPRG-VDYTKF-------RDAIIKWYREFGEkDLPWRKAGD------------------PWAVLVAALLLRKTTVKQVVD 59
gi 15639334   4 LSQSAGDIEKF-------QNAILDFYAQQGR-DFPWRSTCD------------------AYAILVSEFMLQQTQTERVCP 57
gi 15790507   4 GDGSDRAGATGpadttalQTALVDWYTDSHR-SFPWRETTD------------------PYEILVSEVMSQQTQLSRVID 64
gi 15611200   1 -------METL-------HNALLKWYEEFGRkDLPFRNLKGin---------------aPYEVYISEVMSQQTQISTVIE 51
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1723233   83 -YYTKWMETLPTLKSCAEAEYNtQVMPLWSGMG--FYTRCKRLHQACQHLAKLHPSEIPRTGDEWAKgIPGVGPYTAGAV 159
gi 14601039 120 -VYEEFLRRYPNPKALASARED-EVRELIRPLGi-EHQRAKHLIELAKHIEARYGGRIPCSKEKLKE-LPGVGDYIASEV 195
gi 15894778  55 -PYFRIINKYKNIHELAESEDV-FLKNVFKGIG--LFYRADRLKNIAGNIVNYNKKVIPDKWDELIK-IKGIGYYICSAL 129
gi 15792925  66 rFYFPFLQKFPTLESLANANED-ELLKAWQGLG--YYTRARNLKKAALECVDKFGAKLPKDVEDLKK-LSGIGAYTAGAI 141
gi 15644772  52 rFYSPFLEAFPTLKDLANAQLE-EVLLLWRGLG--YYSRAKNLKKSAEICVKEHHSQLPNDYQSLLK-LPGIGAYTANAI 127
gi 15678524  13 -IYENFVEKFPDFKSVCEAGQE-TIEKEMESLG--LRWRARNLHKLACEIESRHGGAVPKNKNDLLE-LPGIGNYISSAF 87
gi 18313897  60 -IYREFLRRYPSPARLADASVE-EIKAIIQPLGm-EHVRATLLKKLSEELVRRFNGQIPCDRDALKS-LPGVGDYAASEV 135
gi 15639334  58 -KYAEWLHRFPSLESLACAPFA-HVLQAWIGLG--YNRRARFLHQSAKLIVERYCAVVPDDPSELKK-LPGVGDYTAAAV 132
gi 15790507  65 -AWRAFLDRWPTTAALAAADRS-DVVGFWSAHSlgYNNRATHLHEAAQQVETDYDGAIPRTPAELSE-LMGVGPYTANAV 141
gi 15611200  52 rFYPPFLKAFPTLKDLANAPLE-EVLLLWRGLG--YYSRAKNLKKSAEICVKEHHSQLPNDYQSLLK-LPGIGAYTANAI 127
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1723233  160 LSIAWKQPTGIVDGNVIRVLSRALAIHSDCSKGKANALIWKLANELVDPVR--PGDFNQALMELGAITCTPQS-PRCSV- 235
gi 14601039 196 LLAACGSPEPLLDRNMIRILERVLGVKSAKKRPHTDPKMWSTARRIVPKDPdmAKEFNYGMLDLARKICTARK-PLCTE- 273
gi 15894778 130 LCFGFNKPYAVLDTNVIRIFERIFDIKSEKKRPRDDIKLFEFAQLLIPEDR--YVDYNYAILDFGACICTMYN-PKCSQ- 205
gi 15792925 142 ACFGYDQKVSFVDGNIRRVLSRLFALE-----NPSMKELEKRAKELLNLNh--AFDHNQALLDIGALVCVGKN-AKCRI- 212
gi 15644772 128 LCFGFREKRACVDANIKRVLLRLFGLDP----NIHAKDLQIKANEFLNLNe--SFNHNQALIDLGALICSPK--PKCAI- 198
gi 15678524  88 LCFSKNIPEPLLDTNTVRIIGRLFDLEISDS-SRRKKDFETVMRKILEFGD--CRHLSLSMIDFGEAVCRASD-PLCHE- 162
gi 18313897 136 LLTACGKPEPLLDRNMIRVIERVFGIKSKKRRPHTDRELWNFARSLVPRDPelAKEFNFGVLDFARKVCTAKS-PKCSL- 213
gi 15639334 133 ACFAYNKATVFLETNIRAVFIRFFFPDTHQV---SDRELLSLVRCTLYEEN--PRRWYYALMDYGAVLKRKITnPNRRSk 207
gi 15790507 142 ASFAFNAGNAVVDTNVKRVLYRAFEGIRDDD----DPDYRPLANE-LLPDGt-SRVWNNAVMELGAVACQQT--PRCDEa 213
gi 15611200 128 LCFGFREKSACVDANVKRVLLRLFGLDP----NIHAKDLQIKANDFLNLNe--SFNHNQALIDLGALICSPK--PKCAI- 198
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1723233  236 -----CPISEICKAYQEQNVIrdgntikydiedvpcnicitdipskedlqnwvvaRYPVHPAKTKQReERALVVIFQKTD 310
gi 14601039 274 -----CPLN-DICIYYNND------------------------------------------------------------- 286
gi 15894778 206 -----CIFRFNCENI----------------------------------------------------------------- 215
gi 15792925 213 -----CPLY-DFCQGKFHTEL----------------------------------YPRAKKILYESL----NLNLFLFEF 248
gi 15644772 199 -----CPFN-PYCLGKNHLEK----------------------------------HTLKKKQEIIQE----ERYLGVVIQ 234
gi 15678524 163 -----CPLKLSCNFYRRC-------------------------------------------------------------- 175
gi 18313897 214 -----CPLANNVCVFYQKRER----------------------------------V------------------------ 230
gi 15639334 208 hyvkqSPFEGSLRQVRGAVLR-----------------------------------EISGMQHAVREkTLFAKLSFEHER 252
gi 15790507 214 ----eCPLREWCHAYQTGDFTa--------------------------------pDVPTQPSFEGSR-RQFRGRIVRLLG 256
gi 15611200 199 -----CPFN-PYCLGKNHLER----------------------------------HTLKKKQEIIQE----ERYLGVVIQ 234
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1723233  311 PstkekFFLIRKRPSAGLLAGLWDFPTIEFGQeswpKDMDAEFQKSIAQwisndsrslikkyqsrGRYLHIFSHIRKTSH 390
gi 14601039     --------------------------------------------------------------------------------
gi 15894778     --------------------------------------------------------------------------------
gi 15792925 249 N-----KKFAIQKSQDKLYKGMYNFPFFKEGE----YKLSKDMG--FVG-----------------EFKHSYTKYKLNIK 300
gi 15644772 235 N-----NQIALEKIEQKLYLGMHHFPDLKEN-------LECKLP--FLG-----------------AIKHSHTKFKLHLN 283
gi 15678524     --------------------------------------------------------------------------------
gi 18313897     --------------------------------------------------------------------------------
gi 15639334 253 L-----SRALDSLVSEGLVVKTEAGYSIAD-------------------------------------------------- 277
gi 15790507 257 ------EHDEMELDALGHRVRVDYTPDGEYGRewlrGLLSDLADDGLVR----------------TEYRGERTVVRLE-- 312
gi 15611200 235 N-----NQIALEKIEQKLYLGMHHFPNLKEN-------LEFKLP--FLG-----------------TIKHSHTKFKLNLN 283
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....
gi 1723233  391 vFYAIASPdiVTNeDFFWISQSDLEHvgmcelglknyrAALEIKKRKVTSLSNF 444
gi 14601039     ------------------------------------------------------
gi 15894778     ------------------------------------------------------
gi 15792925 301 -VYHQILN--NENkNYEFKTLKELES------------TALSALSLKALKLIKL 339
gi 15644772 284 -LYSAAIK--DLKnPVRFYSLKDLET------------LPISSMTLKILNFLKQ 322
gi 15678524     ------------------------------------------------------
gi 18313897     ------------------------------------------------------
gi 15639334     ------------------------------------------------------
gi 15790507     ------------------------------------------------------
gi 15611200 284 -LYLATTK--DLKnPIRFYSLKDLET------------LPISSMTLKILNFLKQ 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap