Conserved Protein Domain Family
PotC

?
COG1177: PotC 
ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 224098
View PSSM: COG1177
Aligned: 98 rows
Threshold Bit Score: 157.733
Threshold Setting Gi: 17988829
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16127365  45 YLRR------WQMQAWLAAVFIFLYAPLIALMAFSFNDSK-RNIVWK--GFTLKYYEKLFN-Ns-------ELLEAFGNS 107 Caulobacter crescen...
15891840   1 MHQEkrgrefYILAFFFVLFVLFLYGPLSAILILAFQGPN-GGLTFPlnGVSLHWFGNLFEqQav-----gDFGGSFRRS 74  Agrobacterium tumef...
15890560   1 --MTrqlfipLT----LLLVVGFLIGPFLIIVAASFSAGD-TLA-FPpqGFSLKWIAKVFTvE--------SFRESFAMS 64  Agrobacterium tumef...
16119473   1 METRsqirarAFVKAWTAFVVLAVYLPILCGALAGLSKGR--YFGFPirVFSTEWWGKTLAsL--------EIQTLVQNS 70  Agrobacterium tumef...
16119640   6 ENPVpailykAFVFGFGGVSLIYLVAPIVIAITMSFTSGQ--TLKYPpeGFSLRWYEALLDpIrs-----gTEHIAAGNS 78  Agrobacterium tumef...
16262664   1 --MTgsksksFVLWAFVTTALLMLSAPTVVVLGASFTAGN--IITFPpdGLSLKWYGAIAQaS--------DLRQAFVRS 68  Sinorhizobium meliloti
16263642   1 --MTrwdissIALRLVTFSMMAFLIFPIAVTLIVAVNPRE---FVLPpnGFTLDWFRAAWSsK--------TFLRGMGVS 67  Sinorhizobium meliloti
16264527   1 --MNsrlfpvTV----LVLVTAFLIGPFFIIVAASLSEGE-TLA-FPpqGLSLKWVAKVFEvE--------SFRESFAMS 64  Sinorhizobium meliloti
13476967   1 MSHEkrtlefYVLAAFFALFVLFLYGPLSAILILSFQGET-GGLTFPlnGVSLHWFANLFErQsv-----gDFGGSFKRS 74  Mesorhizobium loti
13488185   5 TATGrfgiewQLVNGITCMLLALMLAPICMVLVISFTSGEtLQFPPP--ALSLRWYQEVWTmLvgpdagigRLRESLLVS 82  Mesorhizobium loti
16127365 108 LTIAAASTVISLFLGAAVALALWRFRFPGKTAVDGAMALPIVVPEICMGVAMLVFFAKVLpwpqgmpWPLNLGAIIIAHV 187 Caulobacter crescen...
15891840  75 FGLGLMVMTVTVFVSLLAGLAFRR-KFIGATPLFYLSVASLVVPSIIISLGIGVLFQQLGl------EPSWYTSAFGAHL 147 Agrobacterium tumef...
15890560  65 MFLAIGGTFTALILGIPASYAMSRYKLPFAETVRTIVSAPIIVPGIIVGLALLRYFVVPf-------GIGITLALFLAHT 137 Agrobacterium tumef...
16119473  71 ILIAFIVTLVSVILAFFGALAFARYEWKGRKLFQKAILLPVFFPQPVLGLALLLWFNALG-------INPSWQTAVVAHL 143 Agrobacterium tumef...
16119640  79 LKIAGLAVLGSLLFAVPATIGMARMQRRSVNTIEPLLLAPLVLPSLVYGLAALIVANFVG-------LQPSLWLTVIGHV 151 Agrobacterium tumef...
16262664  69 LIVATICTLVSIPVGTLAGIALAKYRVRFARSIQIYLLLPFTIPLIGSGIGMMLVLGNMG-------VLGKLWPVGIACA 141 Sinorhizobium meliloti
16263642  68 LVLGLAAALIANALALPAAIALARTNFPGKGAINLILMTPLLIPTTILSLALYIYFVRVG-------YGSGLVPLLVGHA 140 Sinorhizobium meliloti
16264527  65 MLLAIGGTAAALALGIPASYALSRYRLPFGETVRTVVSLPIIVPGIIVGLALLRYLVVPf-------GFNITLALFLAHT 137 Sinorhizobium meliloti
13476967  75 LVLGLMVMVVTVIVSLLAGLAFRR-KFRGATALFYLAVASLVVPSIIISLGIGVVFQQVGl------RPAWYTSAFGAHL 147 Mesorhizobium loti
13488185  83 LEIAALTSLVCVLAGVPASYALVRYRFAGKTLIEELIGLPVVFPAVVLGIALLVLVSASG-------LDFGIFQIVVAHS 155 Mesorhizobium loti
16127365 188 SFSFPFVAVVVRARMASFNREMEEAARDLGAGEFRTIKDVILPHMAPSLIAGALLAFTLSLDDFVITFFTAGPDTVTFPV 267 Caulobacter crescen...
15891840 148 TWTLPFGVLIMLAVFNRFSPSYEEAARDLGASSWQTFAHVVLPMIAPSLIGVGLFGFTLSYDEFAR-TLMTSGTYNTLPL 226 Agrobacterium tumef...
15890560 138 ALILPYAVRVVSASLNNLRSDIEEAAVLLGSSRLGAFFRVVLPNIRGGILSAFILGFVTSFNQVPVSLFLSGPGVRTLPI 217 Agrobacterium tumef...
16119473 144 VWIVPVVTLVIAIQVYSFDPTLEEAARDLGASRWFILREITLPILWPGIWSGALFAFLLSWGNFPLSLYTAG-VDSTIPK 222 Agrobacterium tumef...
16119640 152 VVFGPLMYRAASVVAQGINPSLAEASTVMGATWFTTLRRVSLPLLTPGILAGAFLVFIQSLDNVSVSLFLADAQTTVLPL 231 Agrobacterium tumef...
16262664 142 VINLPFMIWAVTASASNLSPDLELAAANCGAPPLQRFLYITLPAVLPGVITGSLLMFILALNEFLVSLLLVDARSVTLPV 221 Sinorhizobium meliloti
16263642 141 IHIMPYAVRILTASLLNFDPSYEEAARNVGAGRIRTLFSVTLPVIRTGLISSLTLCFILSWNDFPISVFLAPPSWTPLPV 220 Sinorhizobium meliloti
16264527 138 ALVLPYAVRVVSASLNNLRSDIEEAAVLLGSSRAGAFFRVVMPNIRSGILAAFILGFVTSFNQVPVSLFLSGPGVRTLPI 217 Sinorhizobium meliloti
13476967 148 TWTLPFGVLIMFAVFNRFSPAYEEAARDLGATSWQTFVHVVLPMIAPSLIGVGLFGFTLSYDEFAR-TLMTSGTFNTLPL 226 Mesorhizobium loti
13488185 156 IIGLPFLMRNCMAAMRGIDPMLEEAAMTLGASAPKVFREIVLPLASGGIASGAILVFILSFNEFTLSYFLYS--VDVFPL 233 Mesorhizobium loti
16127365 268 KVYSMVRFS--VTPEVNAASTVLIV--LTVLLTAAALKLQGN---PAAAAG 311 Caulobacter crescentus CB15
15891840 227 EIYGMTTNV--TTPVLYALGAVTTL--FSLLVIAATLGLIVT---LNRRHS 270 Agrobacterium tumefaciens str. C58 (Cereon)
15890560 218 DMLGYMEIV--FDPSVAALSSLLAF--LSIGIVFMAERFLGF---SRYV-- 259 Agrobacterium tumefaciens str. C58 (Cereon)
16119473 223 WLYSKMVAG--YSPMVPALGTMSTLsaAALLLAGGLTIMLVR---RRQADA 268 Agrobacterium tumefaciens str. C58 (Cereon)
16119640 232 RMFALIEES--LDVRVAAMSGLLIG--LTLVVMLVARRVLAP----TRQA- 273 Agrobacterium tumefaciens str. C58 (Cereon)
16262664 222 QIYNSIRSI--ITPDLAAISVVFIA--CAGLAIALLDRLVGLdifLKSK-- 266 Sinorhizobium meliloti
16263642 221 ELYSYIKFQ--YDAVAAALASSLIL--LSAVAMVVIDRLAGLr--RVLRS- 264 Sinorhizobium meliloti
16264527 218 DMLSYMEVT--YDPSVAALSALLAF--MSIGIVFLAERFLGF---SRYV-- 259 Sinorhizobium meliloti
13476967 227 EIYGMTTNV--TTPVLYALGTVTTV--FSFLVILATLGAILY---VGRRRA 270 Mesorhizobium loti
13488185 234 SIWLFQQANtsFSPAVFAVSSLIVVvnVAAVLVVDAVIGSRG---SAA--- 278 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap