Conserved Protein Domain Family
PotC

?
COG1177: PotC 
ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 224098
View PSSM: COG1177
Aligned: 98 rows
Threshold Bit Score: 157.733
Threshold Setting Gi: 17988829
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127365  45 YLRR------WQMQAWLAAVFIFLYAPLIALMAFSFNDSK-RNIVWK--GFTLKYYEKLFN-Ns-------ELLEAFGNS 107
gi 15891840   1 MHQEkrgrefYILAFFFVLFVLFLYGPLSAILILAFQGPN-GGLTFPlnGVSLHWFGNLFEqQav-----gDFGGSFRRS 74
gi 15890560   1 --MTrqlfipLT----LLLVVGFLIGPFLIIVAASFSAGD-TLA-FPpqGFSLKWIAKVFTvE--------SFRESFAMS 64
gi 16119473   1 METRsqirarAFVKAWTAFVVLAVYLPILCGALAGLSKGR--YFGFPirVFSTEWWGKTLAsL--------EIQTLVQNS 70
gi 16119640   6 ENPVpailykAFVFGFGGVSLIYLVAPIVIAITMSFTSGQ--TLKYPpeGFSLRWYEALLDpIrs-----gTEHIAAGNS 78
gi 16262664   1 --MTgsksksFVLWAFVTTALLMLSAPTVVVLGASFTAGN--IITFPpdGLSLKWYGAIAQaS--------DLRQAFVRS 68
gi 16263642   1 --MTrwdissIALRLVTFSMMAFLIFPIAVTLIVAVNPRE---FVLPpnGFTLDWFRAAWSsK--------TFLRGMGVS 67
gi 16264527   1 --MNsrlfpvTV----LVLVTAFLIGPFFIIVAASLSEGE-TLA-FPpqGLSLKWVAKVFEvE--------SFRESFAMS 64
gi 13476967   1 MSHEkrtlefYVLAAFFALFVLFLYGPLSAILILSFQGET-GGLTFPlnGVSLHWFANLFErQsv-----gDFGGSFKRS 74
gi 13488185   5 TATGrfgiewQLVNGITCMLLALMLAPICMVLVISFTSGEtLQFPPP--ALSLRWYQEVWTmLvgpdagigRLRESLLVS 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127365 108 LTIAAASTVISLFLGAAVALALWRFRFPGKTAVDGAMALPIVVPEICMGVAMLVFFAKVLpwpqgmpWPLNLGAIIIAHV 187
gi 15891840  75 FGLGLMVMTVTVFVSLLAGLAFRR-KFIGATPLFYLSVASLVVPSIIISLGIGVLFQQLGl------EPSWYTSAFGAHL 147
gi 15890560  65 MFLAIGGTFTALILGIPASYAMSRYKLPFAETVRTIVSAPIIVPGIIVGLALLRYFVVPf-------GIGITLALFLAHT 137
gi 16119473  71 ILIAFIVTLVSVILAFFGALAFARYEWKGRKLFQKAILLPVFFPQPVLGLALLLWFNALG-------INPSWQTAVVAHL 143
gi 16119640  79 LKIAGLAVLGSLLFAVPATIGMARMQRRSVNTIEPLLLAPLVLPSLVYGLAALIVANFVG-------LQPSLWLTVIGHV 151
gi 16262664  69 LIVATICTLVSIPVGTLAGIALAKYRVRFARSIQIYLLLPFTIPLIGSGIGMMLVLGNMG-------VLGKLWPVGIACA 141
gi 16263642  68 LVLGLAAALIANALALPAAIALARTNFPGKGAINLILMTPLLIPTTILSLALYIYFVRVG-------YGSGLVPLLVGHA 140
gi 16264527  65 MLLAIGGTAAALALGIPASYALSRYRLPFGETVRTVVSLPIIVPGIIVGLALLRYLVVPf-------GFNITLALFLAHT 137
gi 13476967  75 LVLGLMVMVVTVIVSLLAGLAFRR-KFRGATALFYLAVASLVVPSIIISLGIGVVFQQVGl------RPAWYTSAFGAHL 147
gi 13488185  83 LEIAALTSLVCVLAGVPASYALVRYRFAGKTLIEELIGLPVVFPAVVLGIALLVLVSASG-------LDFGIFQIVVAHS 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16127365 188 SFSFPFVAVVVRARMASFNREMEEAARDLGAGEFRTIKDVILPHMAPSLIAGALLAFTLSLDDFVITFFTAGPDTVTFPV 267
gi 15891840 148 TWTLPFGVLIMLAVFNRFSPSYEEAARDLGASSWQTFAHVVLPMIAPSLIGVGLFGFTLSYDEFAR-TLMTSGTYNTLPL 226
gi 15890560 138 ALILPYAVRVVSASLNNLRSDIEEAAVLLGSSRLGAFFRVVLPNIRGGILSAFILGFVTSFNQVPVSLFLSGPGVRTLPI 217
gi 16119473 144 VWIVPVVTLVIAIQVYSFDPTLEEAARDLGASRWFILREITLPILWPGIWSGALFAFLLSWGNFPLSLYTAG-VDSTIPK 222
gi 16119640 152 VVFGPLMYRAASVVAQGINPSLAEASTVMGATWFTTLRRVSLPLLTPGILAGAFLVFIQSLDNVSVSLFLADAQTTVLPL 231
gi 16262664 142 VINLPFMIWAVTASASNLSPDLELAAANCGAPPLQRFLYITLPAVLPGVITGSLLMFILALNEFLVSLLLVDARSVTLPV 221
gi 16263642 141 IHIMPYAVRILTASLLNFDPSYEEAARNVGAGRIRTLFSVTLPVIRTGLISSLTLCFILSWNDFPISVFLAPPSWTPLPV 220
gi 16264527 138 ALVLPYAVRVVSASLNNLRSDIEEAAVLLGSSRAGAFFRVVMPNIRSGILAAFILGFVTSFNQVPVSLFLSGPGVRTLPI 217
gi 13476967 148 TWTLPFGVLIMFAVFNRFSPAYEEAARDLGATSWQTFVHVVLPMIAPSLIGVGLFGFTLSYDEFAR-TLMTSGTFNTLPL 226
gi 13488185 156 IIGLPFLMRNCMAAMRGIDPMLEEAAMTLGASAPKVFREIVLPLASGGIASGAILVFILSFNEFTLSYFLYS--VDVFPL 233
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|.
gi 16127365 268 KVYSMVRFS--VTPEVNAASTVLIV--LTVLLTAAALKLQGN---PAAAAG 311
gi 15891840 227 EIYGMTTNV--TTPVLYALGAVTTL--FSLLVIAATLGLIVT---LNRRHS 270
gi 15890560 218 DMLGYMEIV--FDPSVAALSSLLAF--LSIGIVFMAERFLGF---SRYV-- 259
gi 16119473 223 WLYSKMVAG--YSPMVPALGTMSTLsaAALLLAGGLTIMLVR---RRQADA 268
gi 16119640 232 RMFALIEES--LDVRVAAMSGLLIG--LTLVVMLVARRVLAP----TRQA- 273
gi 16262664 222 QIYNSIRSI--ITPDLAAISVVFIA--CAGLAIALLDRLVGLdifLKSK-- 266
gi 16263642 221 ELYSYIKFQ--YDAVAAALASSLIL--LSAVAMVVIDRLAGLr--RVLRS- 264
gi 16264527 218 DMLSYMEVT--YDPSVAALSALLAF--MSIGIVFLAERFLGF---SRYV-- 259
gi 13476967 227 EIYGMTTNV--TTPVLYALGTVTTV--FSFLVILATLGAILY---VGRRRA 270
gi 13488185 234 SIWLFQQANtsFSPAVFAVSSLIVVvnVAAVLVVDAVIGSRG---SAA--- 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap